DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34462 and Cpr92F

DIOPT Version :9

Sequence 1:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster


Alignment Length:241 Identity:53/241 - (21%)
Similarity:85/241 - (35%) Gaps:57/241 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VRNYFVH-EPYGPNTYSFGYEINDPQTQNSQFREEKRFVNGSIQGSYGYARPDGRIEVTKYMAKE 111
            |...:.| :|:. :|||:||.  ||.:|    :.|.|..:|:..|||.|....|.::...|.|..
  Fly    23 VSTQYQHLDPHS-HTYSYGYA--DPNSQ----KHETRSHDGTTHGSYSYVDGHGHVQSVSYTADP 80

  Fly   112 DGGYSAQIQIFKAGDEKVKSVWPTERPDILVERSKSDAPSNITWDPKSHLNV------------- 163
            ..|::|           |.:..| :.|.:......:.|.::..:.|.:|..:             
  Fly    81 HHGFNA-----------VGTNLP-QAPQVHAAPVYAAAHAHGAYAPYAHGPIHIPVLTHGGVPVD 133

  Fly   164 --TVSHV-ADHVAQQLKQQHGLDLNHIDVTKDVLKPAVLDVIQGKEPTKGRPVQNLIPQHFPIVP 225
              .|.|. |.|.|......|....:|:....          |.|.....|:..      |.|:..
  Fly   134 TPEVQHAKAAHAAAHAAAAHNAGGHHLYKRS----------IYGGGWAYGQAA------HVPLTH 182

  Fly   226 FQLPADQETTKATTAEPQKTESSKY-HRAQSNNAEKAQQVEEPEAR 270
            ..:|.|....:|..||.....:... |.|.::.|    .||.||.:
  Fly   183 GGVPVDTPDVQAAKAEHYAAHAKALGHVAHAHGA----PVETPEVQ 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:278791 17/50 (34%)
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.