DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34462 and Cpr92A

DIOPT Version :9

Sequence 1:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster


Alignment Length:264 Identity:66/264 - (25%)
Similarity:86/264 - (32%) Gaps:78/264 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YAALSNPLSSKIEVYNQPEVTPEKERAKVRNYFVHEPYGPN-TYSFGYEINDPQTQNSQFREEKR 83
            ||....||..       |.|.|:..        ..|||.|: .|||||:|.|..|.:.:.:.|.|
  Fly    40 YAPQHGPLPG-------PYVAPKPA--------APEPYDPDPKYSFGYDIQDGYTGDLKSQHETR 89

  Fly    84 FVNGS-IQGSYGYARPDGRIEVTKYMAKEDGGYSAQIQ----IFKAGDEKVKSVWPTERPDILVE 143
              :|. ::|||....|||......|.|....|::|.::    .:||.......|.|...|   |.
  Fly    90 --HGDVVKGSYSVVDPDGTKRTVDYTADPHHGFNAVVRKEPLAYKAPAHLAPVVAPAPAP---VP 149

  Fly   144 RSKSDAPS-NITWDPKSHLNVTVSHVADHVAQQLKQQHGLDLNHIDVTKDVLKPAVLDVIQGKEP 207
            .....||: .:...||:.|              |.....|...|                     
  Fly   150 AHYGPAPAPPLPPVPKAPL--------------LSYPLALGPYH--------------------- 179

  Fly   208 TKGRPVQNLIPQHFPIVPFQLPADQETTKATTAEPQKTESSKYHRAQSNNAEKAQQVEEPEARLP 272
             :|.|.    |...| .|...||......||...|    |:.:|.|....|      ..|.|..|
  Fly   180 -RGAPA----PAPGP-APAPAPAPVSVPVATPVLP----SAHFHAAYPALA------HSPYAHYP 228

  Fly   273 PPGP 276
            .|||
  Fly   229 APGP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:278791 19/51 (37%)
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 17/51 (33%)
Chitin_bind_4 68..120 CDD:278791 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.