DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34462 and Ccp84Ag

DIOPT Version :9

Sequence 1:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster


Alignment Length:85 Identity:23/85 - (27%)
Similarity:38/85 - (44%) Gaps:8/85 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PEVTPEKERAKVRNYFVHEPYGPNTYSFGYEINDPQTQNSQFREEKRFVNGS-IQGSYGYARPDG 100
            |...|....|:|..|..|.     .|::||::.|..:.:|:.:.|.|  .|. :||.|.....||
  Fly    22 PAAAPLAAVAQVEEYDPHP-----QYTYGYDVKDAISGDSKTQVETR--EGDVVQGQYSLNDADG 79

  Fly   101 RIEVTKYMAKEDGGYSAQIQ 120
            ...:..|.|....|::|.::
  Fly    80 YRRIVDYTADPINGFNAVVR 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:278791 15/51 (29%)
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 15/53 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.