DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34462 and Cpr76Bd

DIOPT Version :10

Sequence 1:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster


Alignment Length:108 Identity:30/108 - (27%)
Similarity:56/108 - (51%) Gaps:20/108 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ALSN--PLSSKIEVYNQP-------EVTPEKERAKVRNYFVHEPYGPNTYSFGYEINDPQTQNSQ 77
            |||:  |:::...:.:.|       :|.|||.   :.::..|.     .|:|.|.:|||.|.:::
  Fly  1115 ALSSHAPVAATAYLKSAPVTQHAVLKVVPEKH---LEHFDAHP-----RYAFEYAVNDPHTGDNK 1171

  Fly    78 FREEKRFVNGS-IQGSYGYARPDGRIEVTKYMAKEDGGYSAQI 119
            .::|:|  :|. ::|.|....|||.:...||.|..:.|:.|::
  Fly  1172 HQKEER--DGDVVKGEYSLVEPDGNVRTVKYYADWETGFHAEV 1212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:459790 18/51 (35%)
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 18/53 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.