DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34462 and Cpr72Ea

DIOPT Version :9

Sequence 1:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster


Alignment Length:324 Identity:63/324 - (19%)
Similarity:107/324 - (33%) Gaps:118/324 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RNYFVHEPYGPNTYSFGYEINDPQTQNSQFREEKRFVNGSIQGSYGYARPDGRIEVTKYMAKEDG 113
            |.|...:..|  .||:||  ::|.:.    ::|.|.::|..||.|.|....|:::...|:|...|
  Fly    38 RQYIAKDELG--QYSYGY--SEPLSS----KQETRTLDGITQGYYSYRDAAGKLQTVNYVADNKG 94

  Fly   114 GYSAQIQIFKAGDEKVKSVWPTERPDILVERSKSDAPSNITWDPKSHLNVTVSHVADH------- 171
            .:.|...:.||   ||    |.|               ::.:.|:|     .||..||       
  Fly    95 FHVAATNLPKA---KV----PQE---------------SLEFSPRS-----ASHPVDHHVEHHAE 132

  Fly   172 ----VAQQLKQQHGLDLNHIDVTKDVLKPAVLD-----------VIQGKEPTKGRPVQNLIPQHF 221
                |.|.....|.:::.|.....:..:.|..|           |...:.|....||:  :|.|.
  Fly   133 VSHAVVQHPVGHHPIEVPHHHTVVESGRSAHPDGHHPVEHHEHRVAVAQHPVGHHPVE--VPHHH 195

  Fly   222 PIV-------------------------------PFQLPADQETTKA-TTAEPQKTESSKYHRAQ 254
            .:|                               |.::|......:: .:|.|:...|.::|   
  Fly   196 TVVETGRSAHPDGHHPVEHHEHPVAVAQHPVGNHPVEVPHHHTVVESGRSAHPEVPHSIEHH--- 257

  Fly   255 SNNAEKAQQVEEPEARLPP----------PGPLVN----SSPSDGNWQRRTIEANRREFLANLP 304
                      |.|.:...|          |.|:.:    ::....:.||...|..|.:.||.:|
  Fly   258 ----------EHPVSGSDPSGSHGGHSQLPHPVSDTAEVAAAKSLHLQRVHDEGVRNQVLAKIP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:278791 15/50 (30%)
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 15/51 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.