DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34462 and Cpr67B

DIOPT Version :9

Sequence 1:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_648306.1 Gene:Cpr67B / 39081 FlyBaseID:FBgn0035985 Length:260 Species:Drosophila melanogaster


Alignment Length:265 Identity:57/265 - (21%)
Similarity:93/265 - (35%) Gaps:87/265 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NPL----SSKIEVYNQPEVTPEKERAKVRNYFVHEPYGPN---TYSFGYEINDPQTQNSQFREEK 82
            |||    :.|.|......|....|.....:|..|:.:|.:   .:::||.      ..:|.:.||
  Fly    54 NPLPEARNEKGEFVYMGRVIEHPEEYVEEHYDAHQYHGQDGLGQFAYGYR------DWNQGKNEK 112

  Fly    83 RFVNGSIQGSYGYARPDGRIEVTKYMAKEDGGYSAQIQIFKAGDEKVK--SVWPTERPDILVERS 145
            |...|.:.|||.|.:|.||..|..|.|.:.|        |...|.:..  .:..|:.|.:|    
  Fly   113 RDETGKVTGSYKYVQPHGRDFVANYYADKTG--------FHVEDNRPAHLKLPATKTPAVL---- 165

  Fly   146 KSDAPSNITWDPKSHLNVTVSHVADHVAQQLKQQHGLDLNHIDVTKDVLKPAVLDVIQGK-EPTK 209
            |::......|   ..|.....|..|..|.:.:|                        :|: :||:
  Fly   166 KAEEEHFKLW---GELAAAAGHNPDPYAAEYQQ------------------------EGRYQPTE 203

  Fly   210 GRPVQNLIPQHFPIV---PFQLPADQETTKATTAEPQ---------------KTESSKYHRAQS- 255
                    |::.|.|   |..:|..:|     |.||:               |.|.::..|.:: 
  Fly   204 --------PEYQPYVHEEPPYVPGPEE-----TGEPKGFFYAFDYNVPLLRNKEERAELERLRAI 255

  Fly   256 NNAEK 260
            ||.::
  Fly   256 NNKDE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:278791 17/50 (34%)
Cpr67BNP_648306.1 Chitin_bind_4 <111..144 CDD:278791 15/40 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.