DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34462 and resilin

DIOPT Version :10

Sequence 1:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_611157.1 Gene:resilin / 36880 FlyBaseID:FBgn0034157 Length:620 Species:Drosophila melanogaster


Alignment Length:63 Identity:21/63 - (33%)
Similarity:30/63 - (47%) Gaps:4/63 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PNTYSFGYEINDPQTQNSQFREEKRFVNGSI-QGSYGYARPDGRIEVTKYMAKEDGGYSAQIQ 120
            |..|.|.|::.|..:..|....|.|  :|.. .|.|....||||.::.:|.|.:. ||..||:
  Fly   342 PAKYEFNYQVEDAPSGLSFGHSEMR--DGDFTTGQYNVLLPDGRKQIVEYEADQQ-GYRPQIR 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:459790 16/51 (31%)
resilinNP_611157.1 Chitin_bind_4 345..396 CDD:459790 16/53 (30%)

Return to query results.
Submit another query.