DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34462 and Cpr50Ca

DIOPT Version :10

Sequence 1:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster


Alignment Length:58 Identity:22/58 - (37%)
Similarity:31/58 - (53%) Gaps:1/58 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 YSFGYEINDPQTQNSQFREEKRFVNGSIQGSYGYARPDGRIEVTKYMAKEDGGYSAQI 119
            |.|||.|.|..|.|....::.|.::|..:|.|....|||||:...|.| :|.|:.|.:
  Fly   751 YEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDGRIQNVIYHA-DDTGFHADV 807

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:459790 19/50 (38%)
Cpr50CaNP_610899.1 PRK10263 <400..>653 CDD:236669
Chitin_bind_4 751..803 CDD:459790 20/52 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.