DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Stacl and Stac

DIOPT Version :9

Sequence 1:NP_001260996.1 Gene:Stacl / 5740318 FlyBaseID:FBgn0263980 Length:1970 Species:Drosophila melanogaster
Sequence 2:XP_343492.4 Gene:Stac / 363152 RGDID:1305745 Length:403 Species:Rattus norvegicus


Alignment Length:539 Identity:126/539 - (23%)
Similarity:201/539 - (37%) Gaps:177/539 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   646 EPTSPRNERKFSAATAPSMKTKWLKAFKSLK-PAGSGSAQQADSQPPRQNQMYHAVSTVLTLRRN 709
            :|.||        |:..|:::|..|..:||. ...|..::.||:..||.|......:.:|.....
  Rat    24 QPPSP--------ASTSSLESKLQKLKRSLSFKTKSLRSKSADNFFPRTNSDVKPQADLLAKASP 80

  Fly   710 GAS------STASEPLRPNL-DGS----HHLQEYTYKKITACDVCSQILRG-HTRQGLRCRICKL 762
            |.|      |.||.|.:..| .||    |..||:.:||.|.||||:.::.| |.:.||||..||:
  Rat    81 GPSPIPIPGSPASMPTKAGLHPGSNSKVHAFQEHVFKKPTFCDVCNHMIVGTHAKHGLRCGACKM 145

  Fly   763 NAHGDCAPNL--PRCQPK-QKLLRRQKSTSELENRVDIEEETGADKSVQAKQMDGSVAGGSALPV 824
            :.|..||..|  .||..| .|..||..|:..|     |.|:.|..|.|                 
  Rat   146 SIHHKCADGLAPQRCMGKLPKGFRRYYSSPLL-----IHEQFGCIKEV----------------- 188

  Fly   825 PVLSERELGRAPPPDIPIVSVSELALQEQQQQQQQQQQQHQQQQRSLASVAQAAAVRAGRGVRPP 889
                           :||.                                      .|..|.|.
  Rat   189 ---------------MPIA--------------------------------------CGNKVDPV 200

  Fly   890 PVAMPILGVQLQQQELQQQRGGLPVPSQDISSSSAPHSPRRQKLNLRMKSLSLDSPESSELHGQF 954
            ..|:. .|..|.|:..:...|         |.|.:|  ||.....|      ::.||.::     
  Rat   201 YEALR-FGTSLAQRTKKSSSG---------SGSDSP--PRTSTSEL------VEVPEEAD----- 242

  Fly   955 RRRTQLPGTGASTSAGSGYYHGGSGGHLEHSTPPSNNSRLHSPSSPSHPGRKLLYATRGMRGGSV 1019
                   |.|.|:                 ...|.:||....|.:                 |:.
  Rat   243 -------GPGDSS-----------------DIRPRSNSVFTYPEN-----------------GTD 266

  Fly  1020 DLPDEME--KSQSSASTSPCLSPKTHRLLPTNLYVIIYNFKARHADELDLKAGYKVTVIDNSDPD 1082
            |..|:::  ..|...|..|         |..|.||.:|.|..:..::|:::.|..:|::::|:.|
  Rat   267 DFRDQVKTINHQGPLSKDP---------LQMNTYVALYRFIPQENEDLEMRPGDMITLLEDSNED 322

  Fly  1083 WWKGKVLGRVGYFPSKYCVRLNANEKPLQVTHNLQVSDSERGENLTLLRDQIVIQTGDEVNGMVM 1147
            |||||:..|||:||:.:..|:..:||..:..... :...::|: :||..:||.:.:.:|.:|.:.
  Rat   323 WWKGKIQDRVGFFPANFVQRVEEHEKIYRCVRTF-IGCKDQGQ-ITLKENQICVTSEEERDGFIR 385

  Fly  1148 IRAAEHGQGYCPIKYLQEV 1166
            :.:.:. :|..|:..|.:|
  Rat   386 VLSGKK-RGLVPLDVLVDV 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StaclNP_001260996.1 BAR 290..489 CDD:299863
C1 727..773 CDD:237996 22/48 (46%)
SH3 1051..1102 CDD:302595 19/50 (38%)
StacXP_343492.4 C1 109..160 CDD:237996 22/50 (44%)
STAC2_u1 167..>262 CDD:293269 33/216 (15%)
SH3_Stac_1 290..342 CDD:212767 19/51 (37%)
SH3 349..399 CDD:302595 9/52 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10604
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45320
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15135
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1389
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.