DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34423 and ATP5IF1

DIOPT Version :10

Sequence 1:NP_001163263.1 Gene:CG34423 / 5740313 FlyBaseID:FBgn0085452 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_057395.1 Gene:ATP5IF1 / 93974 HGNCID:871 Length:106 Species:Homo sapiens


Alignment Length:40 Identity:24/40 - (60%)
Similarity:27/40 - (67%) Gaps:0/40 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GGGSIREAGGSFGKMEAAREEEFFYKQQKEQLKNLKTKTE 76
            |.||||||||:|||.|.|.||.:|..|.:|||..||...|
Human    36 GAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHE 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34423NP_001163263.1 IATP <22..79 CDD:428014 24/40 (60%)
ATP5IF1NP_057395.1 N-terminal inhibitory region. /evidence=ECO:0000250 26..52 12/15 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..51 12/14 (86%)
IATP <36..87 CDD:428014 24/40 (60%)
Antiparallel alpha-helical coiled coil region. /evidence=ECO:0000250 74..106 1/2 (50%)

Return to query results.
Submit another query.