DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34423 and CG13551

DIOPT Version :10

Sequence 1:NP_001163263.1 Gene:CG34423 / 5740313 FlyBaseID:FBgn0085452 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_652302.1 Gene:CG13551 / 50133 FlyBaseID:FBgn0040660 Length:107 Species:Drosophila melanogaster


Alignment Length:74 Identity:51/74 - (68%)
Similarity:61/74 - (82%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFTLRRFSQRWYPKQIQHLKM--SQIGELGSGAGNGGGGGGSIREAGGSFGKMEAAREEEFFYKQ 63
            ||.:||.:.|.||..:|..||  ||:|:||||||.|||||||||||||:|||:|||||||:|||:
  Fly     1 MFVVRRSASRLYPAGVQLAKMSGSQVGDLGSGAGKGGGGGGSIREAGGAFGKLEAAREEEYFYKK 65

  Fly    64 QKEQLKNLK 72
            |:|||..||
  Fly    66 QREQLDRLK 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34423NP_001163263.1 IATP <22..79 CDD:428014 41/51 (80%)
CG13551NP_652302.1 IATP 3..97 CDD:428014 49/72 (68%)

Return to query results.
Submit another query.