DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34423 and Atp5if1

DIOPT Version :10

Sequence 1:NP_001163263.1 Gene:CG34423 / 5740313 FlyBaseID:FBgn0085452 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_037047.2 Gene:Atp5if1 / 25392 RGDID:2181 Length:107 Species:Rattus norvegicus


Alignment Length:68 Identity:26/68 - (38%)
Similarity:38/68 - (55%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LKMSQIGELGSGAGNG-GGGGGSIREAGGSFGKMEAAREEEFFYKQQKEQLKNLKTKTEPKAPEA 82
            :::.|....||.:... ..|.||||||||:|||.|.|.|:.:|.::.:|||..||...|.:....
  Rat    17 MRVLQTRGFGSDSSESMDSGAGSIREAGGAFGKREKAEEDRYFREKTREQLAALKKHHEDEIDHH 81

  Fly    83 PKK 85
            .|:
  Rat    82 SKE 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34423NP_001163263.1 IATP <22..79 CDD:428014 25/57 (44%)
Atp5if1NP_037047.2 IATP 18..87 CDD:428014 26/67 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..58 17/32 (53%)
N-terminal inhibitory region. /evidence=ECO:0000250 26..52 14/25 (56%)
Antiparallel alpha-helical coiled coil region. /evidence=ECO:0000250 74..106 2/11 (18%)

Return to query results.
Submit another query.