DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34423 and mai-2

DIOPT Version :10

Sequence 1:NP_001163263.1 Gene:CG34423 / 5740313 FlyBaseID:FBgn0085452 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_500336.1 Gene:mai-2 / 177106 WormBaseID:WBGene00015248 Length:109 Species:Caenorhabditis elegans


Alignment Length:48 Identity:34/48 - (70%)
Similarity:41/48 - (85%) Gaps:0/48 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GELGSGAGNGGGGGGSIREAGGSFGKMEAAREEEFFYKQQKEQLKNLK 72
            |..|.|||.|||.|||||:|||:|||||||||:|:|||:||.||:.|:
 Worm    21 GGHGDGAGRGGGSGGSIRDAGGAFGKMEAAREDEYFYKKQKAQLQELR 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34423NP_001163263.1 IATP <22..79 CDD:428014 34/48 (71%)
mai-2NP_500336.1 IATP <36..91 CDD:428014 24/33 (73%)

Return to query results.
Submit another query.