DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nox and AIM14

DIOPT Version :9

Sequence 1:NP_001097336.1 Gene:Nox / 5740310 FlyBaseID:FBgn0085428 Length:1340 Species:Drosophila melanogaster
Sequence 2:NP_011355.1 Gene:AIM14 / 852716 SGDID:S000003128 Length:570 Species:Saccharomyces cerevisiae


Alignment Length:326 Identity:76/326 - (23%)
Similarity:126/326 - (38%) Gaps:93/326 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 VFVTYLFFYITVNLCLFISRAIQYRASNGF--VIIARA--CGQCLNFNCAWVLVLM---LRHSLT 578
            |.:..|.:.|.:.|.....|....|:|:.|  .||.|.  ....::....:..||:   ..:|||
Yeast    27 VLIISLVYLIGLALLRAFGRRTPSRSSSAFKNKIIYRLYDIDPAIHLGILFFAVLIPFYYHYSLT 91

  Fly   579 -----YLRGRGLSSY--LPLDHHVYL------------------HKLTGITISVLSLIHTIMHLF 618
                 ||:..|..||  :||:..:.|                  ||.....|:|:.|:|.|..:.
Yeast    92 TQSTVYLKRLGRLSYALIPLNLFLTLRPNWFLRKNCTYTDFIPFHKWFSRIITVIGLLHGIFFII 156

  Fly   619 NFSIIVINDPNINAGHYTIGEWLLTDRPGLFGLIPGCANPTGVALLAILVVMFVCSQPFVRRKGS 683
            .::|    |.|::          |..:     ||....|..|..:..:::.:.:||...:||. :
Yeast   157 KWAI----DDNVS----------LKQK-----LILKTFNFAGFIISILVLFLLICSIGPMRRY-N 201

  Fly   684 FEVFYWTH-LLYVPFWILCLFHG-PNFWKWFLLPG----LVYIVER-----ALRFIWMRGEHGKT 737
            :.:||..| |:.|.|.:|...|. |.....|||..    .::|:.|     :|..:.....:.||
Yeast   202 YRLFYIVHNLVNVAFILLTPIHSRPGVKFPFLLLNCTLLFIHIINRIVFAKSLMILNKNANYSKT 266

  Fly   738 YISSGLLLPSKVVHLVIKR---PHHFNFRPGDYVFVNIPAIANYE------W----HPFTISSAP 789
                      .:||:.:.|   |.:  |.||.::     .|:.|.      |    ||:||:|..
Yeast   267 ----------NLVHVRLPRAILPDY--FEPGSHI-----RISPYRRINPLYWLLPSHPYTIASLA 314

  Fly   790 E 790
            |
Yeast   315 E 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NoxNP_001097336.1 FRQ1 314..466 CDD:227455
EFh 365..425 CDD:238008
EFh 399..462 CDD:238008
Ferric_reduct 560..700 CDD:280043 38/168 (23%)
NOX_Duox_like_FAD_NADP 744..>819 CDD:99783 16/60 (27%)
FNR_like <1136..>1178 CDD:297884
NAD_binding_6 1158..1325 CDD:285298
AIM14NP_011355.1 Ferric_reduct 104..219 CDD:396386 30/134 (22%)
FAD_binding_8 253..365 CDD:285293 19/80 (24%)
NAD_binding_6 372..557 CDD:369657
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.