DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41520 and FCN2

DIOPT Version :10

Sequence 1:NP_001104019.1 Gene:CG41520 / 5740294 FlyBaseID:FBgn0087011 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_004099.2 Gene:FCN2 / 2220 HGNCID:3624 Length:313 Species:Homo sapiens


Alignment Length:222 Identity:96/222 - (43%)
Similarity:128/222 - (57%) Gaps:18/222 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 SCVDILNAGMKQSG---VFYLQIRGTTYWFLKVYCDQETTDGGWTVIQRRDDFKDSRENFNRDWA 577
            :|.|:|:.|...||   ::....|..|     |.||.:|..|||||.|||   .|...:|.||||
Human   104 TCKDLLDRGHFLSGWHTIYLPDCRPLT-----VLCDMDTDGGGWTVFQRR---VDGSVDFYRDWA 160

  Fly   578 DYKNGFGEPSKDFWLGNENIYMLTNNEEYSLRVELEDFEGNKRYAQYSHFKIHSEADYYKLEIDG 642
            .||.|||....:|||||:||:.||......|||:|.|||.|.::|:|..||:..||:.|.|.:..
Human   161 TYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGA 225

  Fly   643 Y-EGNAGDSLNDPWYGSNNSPFSTYNKDNDRSSLNCASMLKGGWWWKSCG-RGLNGLYLHDPQDI 705
            : ||:|||||.    ..||..|||.::|||.::.|||.|.:|.||:|:|. ..|||.||......
Human   226 FVEGSAGDSLT----FHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGS 286

  Fly   706 TARQGIVWFRWRGWDYTLKKSKMMIRP 732
            .| .||.|...:|::|:.|.|:|.:||
Human   287 FA-NGINWKSGKGYNYSYKVSEMKVRP 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41520NP_001104019.1 FReD 516..733 CDD:238040 96/222 (43%)
FCN2NP_004099.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..99
FReD 102..312 CDD:238040 94/220 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.