DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP1A and AT4G03100

DIOPT Version :9

Sequence 1:NP_001284725.1 Gene:RhoGAP1A / 5740235 FlyBaseID:FBgn0025836 Length:1404 Species:Drosophila melanogaster
Sequence 2:NP_192219.2 Gene:AT4G03100 / 828092 AraportID:AT4G03100 Length:430 Species:Arabidopsis thaliana


Alignment Length:246 Identity:62/246 - (25%)
Similarity:106/246 - (43%) Gaps:49/246 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1159 LSLSWLTETTQPKSIKLTETLELGCSFRFIPGEL-----FRGSTKPGALFG--AKMSQVLKREK- 1215
            :.:.|.|.......:    |.:....|..:|.||     .|..:...::||  |:..|....|| 
plant    78 MEIGWPTNVRHITHV----TFDRFHGFLGLPHELQVEIPCRVPSASVSVFGVSAESMQCSYDEKG 138

  Fly  1216 RDIPFIIGACIRE--VERRGMLEVGCYRVSGSASDLAKLKKAFESDAYEAEQLLR-----EVDIH 1273
            ..:|.|: ..::|  ..::|:...|.:|::...|          .:.:..:||.|     .:|:|
plant   139 NSVPTIL-LLMQERLYSQQGLKAEGIFRINPENS----------QEEHVRDQLNRGIVPENIDVH 192

  Fly  1274 SVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNESTRINELLKVFEELPQANKASITSILD 1338
            .:.|::|.:.||||..:. |.|.|.     ...:.|.|    :|.:::.::|.....|.:...:|
plant   193 CLAGLIKAWFRELPSGVL-DGLSPE-----EVLNCNTE----DESVELIKQLKPTESALLNWAVD 247

  Fly  1339 HLIRVHEKETDNKMSLHNLAMVFGPTLLRPGQTQVKQKDPLAA--STVDVM 1387
            .:..|.|:|..|||:..|:||||.|.:     ||:  .|||.|  ..|.||
plant   248 LMADVVEEEESNKMNARNIAMVFAPNM-----TQM--TDPLTALMHAVQVM 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP1ANP_001284725.1 RhoGEF 675..857 CDD:214619
PH_BCR_arthropod 851..1037 CDD:270174
C2 1079..1187 CDD:301316 4/27 (15%)
RhoGAP 1203..1398 CDD:295372 54/197 (27%)
AT4G03100NP_192219.2 PBD 80..113 CDD:197628 7/36 (19%)
RhoGAP 140..298 CDD:214618 48/180 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.