DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP1A and ARHGAP31

DIOPT Version :9

Sequence 1:NP_001284725.1 Gene:RhoGAP1A / 5740235 FlyBaseID:FBgn0025836 Length:1404 Species:Drosophila melanogaster
Sequence 2:NP_065805.2 Gene:ARHGAP31 / 57514 HGNCID:29216 Length:1444 Species:Homo sapiens


Alignment Length:168 Identity:54/168 - (32%)
Similarity:95/168 - (56%) Gaps:9/168 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1203 FGAKMSQVLKREKRDIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKLKKAFESDAYEAEQLL 1267
            ||..:::.|:...:|:|:::.:|...:|..|::: |.||:||..|::.:|::.|.||  :...|.
Human    19 FGCDLTEYLESSGQDVPYVLKSCAEFIETHGIVD-GIYRLSGVTSNIQRLRQEFGSD--QCPDLT 80

  Fly  1268 REV---DIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNESTRINELLKVFEELPQAN 1329
            |||   |||.|..:.|.:.||||..|.|.:||.:|.:   |.|:..|..::..:..|.:|||.::
Human    81 REVYLQDIHCVGSLCKLYFRELPNPLLTYELYEKFTE---AVSHCPEEGQLARIQNVIQELPPSH 142

  Fly  1330 KASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTLLR 1367
            ..::..::.||..:....:...|...|||:|:.|.|||
Human   143 YRTLEYLIRHLAHIASFSSKTNMHARNLALVWAPNLLR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP1ANP_001284725.1 RhoGEF 675..857 CDD:214619
PH_BCR_arthropod 851..1037 CDD:270174
C2 1079..1187 CDD:301316
RhoGAP 1203..1398 CDD:295372 54/168 (32%)
ARHGAP31NP_065805.2 RhoGAP_CdGAP 17..211 CDD:239849 54/168 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..427
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 504..631
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 688..893
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 906..1108
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1211..1346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2255
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.