DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP1A and chn2

DIOPT Version :9

Sequence 1:NP_001284725.1 Gene:RhoGAP1A / 5740235 FlyBaseID:FBgn0025836 Length:1404 Species:Drosophila melanogaster
Sequence 2:XP_699642.6 Gene:chn2 / 570999 ZFINID:ZDB-GENE-091020-5 Length:466 Species:Danio rerio


Alignment Length:188 Identity:58/188 - (30%)
Similarity:99/188 - (52%) Gaps:7/188 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly  1183 CSFRFIPGELFRGSTKPGALFGAKMSQVLKREKRDIPFIIGACIREVERRGMLEVGCYRVSGSAS 1247
            || :.:|.:......:...:|...::.::|......|.::..||||:|.||:...|.|||||...
Zfish   254 CS-KLVPSDCQPD
LRRIKKVFSCDLTTLVKAHNTPRPMVLDMCIREIEHRGLKSEGLYRVSGFTE 317

  Fly  1248 DLAKLKKAFESDAYEAEQLLREV--DIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNN 1310
            .:..::.:|:.|..:|: :...:  ||:.:.|.||.:||:||..:.|..:|.||   ..|....:
Zfish   318 HIEDVRLSFDRDGEKAD-ISANIYPDINIIAGALKLYLRDLPIPVITYDVYSRF---IQAAKITD 378

  Fly  1311 ESTRINELLKVFEELPQANKASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTLLRP 1368
            ..:|:..:.....:||.|:..::..::.||.||...|.||.|:..||.:||||||:||
Zfish   379 PDSRLEAVHDGLLQLPPAHYETLRYLMTHLKRVTMYEKDNYMNSENLGIVFGPTLMRP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP1ANP_001284725.1 RhoGEF 675..857 CDD:214619
PH_BCR_arthropod 851..1037 CDD:270174
C2 1079..1187 CDD:301316 2/3 (67%)
RhoGAP 1203..1398 CDD:295372 55/168 (33%)
chn2XP_699642.6 SH2_a2chimerin_b2chimerin 52..138 CDD:198215
C1_1 213..265 CDD:278556 3/11 (27%)
RhoGAP_chimaerin 273..466 CDD:239837 55/168 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1094
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.