DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP1A and CdGAPr

DIOPT Version :9

Sequence 1:NP_001284725.1 Gene:RhoGAP1A / 5740235 FlyBaseID:FBgn0025836 Length:1404 Species:Drosophila melanogaster
Sequence 2:NP_001260600.1 Gene:CdGAPr / 35267 FlyBaseID:FBgn0032821 Length:1843 Species:Drosophila melanogaster


Alignment Length:176 Identity:53/176 - (30%)
Similarity:94/176 - (53%) Gaps:21/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1202 LFGAKMSQVLKREKRDIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKLKKAFESDAY----- 1261
            :|...:|:.|....:|||.::.:|...:|..|::: |.||:||..|::.:|::||:.:..     
  Fly   421 VFNCDLSEHLLNSGQDIPMVLRSCAEFIENYGVID-GIYRLSGITSNIQRLRRAFDEERVPDLGN 484

  Fly  1262 -EAEQLLREVDIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNESTRINELLKVFEE- 1324
             |.:|     |||:|:.:||.:.||||..|.|.|||..|.:....     ::...:|.|::.:| 
  Fly   485 PEMKQ-----DIHAVSSLLKMYFRELPNPLCTYQLYDNFVEAIQV-----KADEADERLRLMKET 539

  Fly  1325 ---LPQANKASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTLLR 1367
               ||..:..::..:.:||.:|.:......|:..|||:|:.|.|||
  Fly   540 VLKLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPNLLR 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP1ANP_001284725.1 RhoGEF 675..857 CDD:214619
PH_BCR_arthropod 851..1037 CDD:270174
C2 1079..1187 CDD:301316
RhoGAP 1203..1398 CDD:295372 53/175 (30%)
CdGAPrNP_001260600.1 PX_domain 168..274 CDD:295365
SH3_ARHGAP32_33 299..358 CDD:212769
RhoGAP_CdGAP 420..613 CDD:239849 53/176 (30%)
FliJ 1322..1457 CDD:304890
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2255
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.