DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP1A and Arhgap32

DIOPT Version :9

Sequence 1:NP_001284725.1 Gene:RhoGAP1A / 5740235 FlyBaseID:FBgn0025836 Length:1404 Species:Drosophila melanogaster
Sequence 2:XP_006510505.1 Gene:Arhgap32 / 330914 MGIID:2450166 Length:2103 Species:Mus musculus


Alignment Length:497 Identity:114/497 - (22%)
Similarity:198/497 - (39%) Gaps:138/497 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   929 YEEAD-PAVELKESSPANISQVKRNLRSVRDQLAMEVANSGSG--------AFRSGDK------Y 978
            ||..: .:::|..|...| ..:|....|......:::|..|..        .||..||      |
Mouse   139 YENVEFGSIQLSLSEEQN-EVMKNGCESKELVYLVQIACQGKSWIVKRSYEDFRVLDKHLHLCIY 202

  Fly   979 RRKLADL----ESQLVLATPNLVLRL------------GNKAN-NKTITFFLSSDFERTQWIDSI 1026
            .|:.:.|    .|.::..:|..|.::            |||.| ...:|           |::  
Mouse   203 DRRFSQLTELPRSDVLKDSPESVTQMLTAYLSRLSTIAGNKINCGPALT-----------WME-- 254

  Fly  1027 LSLKQKCN---LPGANTINSLEVTAFIVAMQKGMKTEMGSYLMRNTNDESLLVGDL--------- 1079
              :..|.|   :...::||:..|.|..|..:         |..|..::.:|.|||:         
Mouse   255 --IDNKGNHLLVHEESSINTPAVGAAHVIKR---------YTARAPDELTLEVGDIVSVIDMPPK 308

  Fly  1080 -----YMGVHGLE-GLEQANDLYICVEVDSYGHYFRKATTKKICRSQTPLWNESFMLELEGSQNV 1138
                 :.|.||.: ||...:    |||:          ..:|:.:|.|                 
Mouse   309 VLSTWWRGKHGFQVGLFPGH----CVEL----------INQKVPQSVT----------------- 342

  Fly  1139 RILLYEAKERPLLKAKHILKLSLSWLTETTQPKSIKLTETLELGCSFRFIPGELFRGSTKPGALF 1203
                 .:..:|:.| ||...::.......::|...||.:                ||..|. .:|
Mouse   343 -----NSVPKPVSK-KHGKLITFLRTFMKSRPTKQKLKQ----------------RGILKE-RVF 384

  Fly  1204 GAKMSQVLKREKRDIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKLKKAFESDAYEAEQLLR 1268
            |..:.:.|.....::|.::.:|...:||.|::: |.||:||.||::.:|:..|:|:  ....|.:
Mouse   385 GCDLGEHLLNSGFEVPQVLQSCTAFIERYGIVD-GIYRLSGVASNIQRLRHEFDSE--HVPDLTK 446

  Fly  1269 E---VDIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNESTRINELLKVFEELPQANK 1330
            |   .|||||..:.|.:.||||..|.|.|||.:|.|..||.::.....:|::   |.::||..:.
Mouse   447 EPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSDAVSAATDEERLIKIHD---VIQQLPPPHY 508

  Fly  1331 ASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTLLRPGQTQ 1372
            .::..::.||..:.:..:...|...|||:|:.|.|||..|.:
Mouse   509 RTLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNLLRSKQIE 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP1ANP_001284725.1 RhoGEF 675..857 CDD:214619
PH_BCR_arthropod 851..1037 CDD:270174 27/142 (19%)
C2 1079..1187 CDD:301316 18/122 (15%)
RhoGAP 1203..1398 CDD:295372 55/173 (32%)
Arhgap32XP_006510505.1 PX_RICS 141..255 CDD:132831 23/129 (18%)
SH3_ARHGAP32_33 277..330 CDD:212769 13/65 (20%)
RhoGAP_CdGAP 382..576 CDD:239849 55/175 (31%)
PHA03247 <1251..1633 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2255
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.