DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP1A and Graf

DIOPT Version :9

Sequence 1:NP_001284725.1 Gene:RhoGAP1A / 5740235 FlyBaseID:FBgn0025836 Length:1404 Species:Drosophila melanogaster
Sequence 2:NP_001285296.1 Gene:Graf / 32522 FlyBaseID:FBgn0030685 Length:1025 Species:Drosophila melanogaster


Alignment Length:714 Identity:149/714 - (20%)
Similarity:257/714 - (35%) Gaps:245/714 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   770 NYKNAIETV--KKCSANNPQFKKIVSTIVLNLQTEQSLTLEDLLHKPVARVQINALVFNDLLRET 832
            |.:..:|.:  ::|..::|.|::       ||...:. .|:...|: :.|:          ::|.
  Fly     6 NVRRGLEPLEFEECIVDSPDFRE-------NLNRHEK-ELDHTSHQ-IKRI----------IKEV 51

  Fly   833 PNAHPDHQPLRQAQKIIQMFLNQF-------------NVVNQRLP--------IESNRNLRRMVR 876
            .:.....:.|....|.:.:.||.|             ||:.:.|.        ||..|.....:.
  Fly    52 KDLMSAAKILSTRMKQLAILLNDFNFECIGTAQTDDENVICESLKRFGAIIGNIEDEREKMLTLA 116

  Fly   877 NSFIVELVDGHRKLRHLFLFNDVIACAKYKALG-----RDRIDYELKWFI----------PLKDV 926
            :..|:|.::..||                |.:|     :.:.|.:.:.|.          ..|..
  Fly   117 DKHIIESLEDFRK----------------KQIGGVKENKKKFDKKTEKFCQSQERFLNMSTKKPE 165

  Fly   927 SIYEEADPAVEL--KESSPANISQVKRNLRSVRDQLAMEVAN------SG-----SGAFRSGDKY 978
            :..:|||.::.:  :|....::|.|.| ::.|::::..|...      ||     ..|....:.:
  Fly   166 NTIQEADASLGMHEREYIQESLSYVLR-IQEVQERIKFEFVEILLAFISGWLVFYHTAHEQAEDH 229

  Fly   979 RRKLADLESQLVLATPNLVLRLGNKANNKTITFFLSSDFERTQWIDSILSLKQKCNLPGANTINS 1043
            |..|.||..::                .||     ..:||..:  :.:..||.|           
  Fly   230 RDYLQDLRHKV----------------QKT-----RENFEEAR--EKVTELKTK----------- 260

  Fly  1044 LEVTAFIVAMQKGMKTEMGSYLMRNTNDESLLV--GDLYMGVHGLEGLEQANDLYICVEVDSYGH 1106
                                |:.:.|..|.:..  |.|::       :|:::.|.|     |...
  Fly   261 --------------------YMEKRTKPEEIFTKRGYLFL-------MEKSSILKI-----SLLE 293

  Fly  1107 YFRKATTKKIC------RSQTPL----WNESFMLELEGSQNVRILLYEA---------------- 1145
            .|:...||..|      |..|.|    .|.:| ...|...:.::.|:..                
  Fly   294 PFKATWTKYYCTFKKQKREFTMLQFNQMNHNF-TRPEARDDEKLTLFSCQRRASEFEKRFCFDLT 357

  Fly  1146 -KERP--------LLKAKHILKLSLSWLTETT--QPKSIKLTETLELGCSFRFIPGELFRGSTKP 1199
             ||:|        |.:..|...:|....||.|  .|..||::|...|               .:.
  Fly   358 FKEKPGVVYTFQALSEKDHRYWISAMDGTEPTYLAPGKIKVSEAYHL---------------DEA 407

  Fly  1200 GALFGAKMSQVLKREKRDIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKL------KKAFES 1258
            |.:|                  |..||:.:|.||:.:.|.||.||..:.::||      :|  ||
  Fly   408 GFMF------------------IRRCIQVLEIRGLEDEGIYRKSGVGTKISKLLALGLNQK--ES 452

  Fly  1259 DAYEAEQLLRE-VDIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNESTRINELLKVF 1322
            |....:...|: ::.:::...||.:||.|.|.|.|.|.:..|.:   |......:.|:||:.|:.
  Fly   453 DDVFVDDKYRDLMESNTIASALKMYLRNLNEPLMTYQYHSDFIE---AAKQETLNQRVNEVHKLV 514

  Fly  1323 EELPQANKASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTLLRPGQTQVKQKDPLAASTVDV 1386
            .:|||.|...:..::.||..|..|...||||:.||.:|||||||||.:..|       |:.:|:
  Fly   515 YKLPQPNFQMLDMVICHLTDVSRKYEKNKMSVFNLGVVFGPTLLRPREESV-------AAILDI 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP1ANP_001284725.1 RhoGEF 675..857 CDD:214619 16/101 (16%)
PH_BCR_arthropod 851..1037 CDD:270174 41/234 (18%)
C2 1079..1187 CDD:301316 30/144 (21%)
RhoGAP 1203..1398 CDD:295372 60/191 (31%)
GrafNP_001285296.1 BAR_RhoGAP_OPHN1-like 27..233 CDD:153286 39/241 (16%)
BAR-PH_GRAF_family 273..390 CDD:269953 25/129 (19%)
PH 279..383 CDD:278594 21/116 (18%)
RhoGAP 383..584 CDD:295372 69/234 (29%)
SH3_GRAF-like 967..1020 CDD:212815
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1094
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.