DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP1A and RhoGAP5A

DIOPT Version :9

Sequence 1:NP_001284725.1 Gene:RhoGAP1A / 5740235 FlyBaseID:FBgn0025836 Length:1404 Species:Drosophila melanogaster
Sequence 2:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster


Alignment Length:478 Identity:110/478 - (23%)
Similarity:178/478 - (37%) Gaps:145/478 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   961 AMEVANSGSGAFRSGDKYRRKLADLESQLVLATPNLVLRLGNKANNKTITFFLSSDFERTQWIDS 1025
            |:|..|.....:  |.:|...:..||::.:|            ||.:..::|:    .|:...|.
  Fly    68 AVEANNLAGRLY--GSEYHGLMGHLEAEQLL------------ANARDGSYFV----RRSPQSDG 114

  Fly  1026 ILSLKQKCN----------LPGANTINSLEVTAFIVAMQKGMKTEMGSYLMRNTNDESLLVGDL- 1079
            ..:|..:.|          .||                       :|.|| |..:.....|.|: 
  Fly   115 YYTLSLRFNKRPKHYKLLYKPG-----------------------VGHYL-RGQDKRFDTVHDMV 155

  Fly  1080 -------YMGVHGLEGLEQANDLYICVEVDSYGHYFRKATTKKICRSQTPLWNESFMLELEGSQN 1137
                   :|.:|....::|.|.                  ..|.|..|:|      .:.|.| :.
  Fly   156 ADGLINFHMQLHASPIIQQINQ------------------QTKNCYQQSP------YMTLNG-RK 195

  Fly  1138 VRILLYE-----AKE-----------------------RPLLKAK-HILKL----SLSWLTETTQ 1169
            :|.|..|     |||                       .||:..| |..|:    .|:|......
  Fly   196 LRALSNELGKAAAKESKESPAEEKEQKQEEPPPPAVDPMPLVYEKPHHFKVHTFKGLNWCEFCAN 260

  Fly  1170 ------PKSIKLTETLELGCSF-------RFIPGELFRGSTKPGALFGAKMSQVLKRE-KRDIPF 1220
                  .:.:|..     .|.|       ..:|.:......:...:||..::.:::.| ...|||
  Fly   261 FLWGFTAQGVKCE-----ACGFVAHSKCSELVPPKCVPDLKRIRGVFGTDLTTMVQLEPHHQIPF 320

  Fly  1221 IIGACIREVERRGMLEVGCYRVSGSASDLAKLKKAFESDAYEAEQLLREV---DIHSVTGILKTF 1282
            ::..|:.|||.||||:.|.|||||.|.::..||.|.:.:..:.:  :.|.   :::.:.|.||.:
  Fly   321 VVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTD--MSETAYGNVNVIAGTLKLY 383

  Fly  1283 LRELPEALFTDQLYPRFFDTFSAFSNNNESTRINELLKVFEELPQANKASITSILDHLIRVHEKE 1347
            ||.||..|.|.|.||.|   .:|.....::.:...:.:....||.|:.:.:..:|:||.||....
  Fly   384 LRLLPVPLITFQAYPSF---MAAGRTGKQAEQRQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHY 445

  Fly  1348 TDNKMSLHNLAMVFGPTLLRPGQ 1370
            ..|||:.||||.||.|||:...|
  Fly   446 AVNKMNEHNLATVFAPTLIATPQ 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP1ANP_001284725.1 RhoGEF 675..857 CDD:214619
PH_BCR_arthropod 851..1037 CDD:270174 15/85 (18%)
C2 1079..1187 CDD:301316 26/161 (16%)
RhoGAP 1203..1398 CDD:295372 60/172 (35%)
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215 21/132 (16%)
C1_1 242..294 CDD:278556 8/56 (14%)
RhoGAP_chimaerin 302..491 CDD:239837 60/172 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46684
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1094
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.