Sequence 1: | NP_001284725.1 | Gene: | RhoGAP1A / 5740235 | FlyBaseID: | FBgn0025836 | Length: | 1404 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001272714.1 | Gene: | Arhgap9 / 216445 | MGIID: | 2143764 | Length: | 648 | Species: | Mus musculus |
Alignment Length: | 197 | Identity: | 68/197 - (34%) |
---|---|---|---|
Similarity: | 101/197 - (51%) | Gaps: | 26/197 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 1192 LFRGSTKPGALFGAKMSQVLKREKRDIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKLK--- 1253
Fly 1254 ---KAFESDA--YEAEQLLRE----------VDIHSVTGILKTFLRELPEALFTDQLYPRFFDTF 1303
Fly 1304 SAFSNNNESTRINELLKVFEELPQANKASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTLLRP 1368
Fly 1369 GQ 1370 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoGAP1A | NP_001284725.1 | RhoGEF | 675..857 | CDD:214619 | |
PH_BCR_arthropod | 851..1037 | CDD:270174 | |||
C2 | 1079..1187 | CDD:301316 | |||
RhoGAP | 1203..1398 | CDD:295372 | 65/186 (35%) | ||
Arhgap9 | NP_001272714.1 | SH3 | 26..82 | CDD:302595 | |
PH_ARHGAP9-like | 236..349 | CDD:270053 | |||
PH | 250..348 | CDD:278594 | |||
ASCH | <346..432 | CDD:294653 | 68/197 (35%) | ||
RhoGAP_ARHGAP27_15_12_9 | 438..642 | CDD:239868 | 65/186 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2255 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |