DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP1A and Arhgap9

DIOPT Version :9

Sequence 1:NP_001284725.1 Gene:RhoGAP1A / 5740235 FlyBaseID:FBgn0025836 Length:1404 Species:Drosophila melanogaster
Sequence 2:NP_001272714.1 Gene:Arhgap9 / 216445 MGIID:2143764 Length:648 Species:Mus musculus


Alignment Length:197 Identity:68/197 - (34%)
Similarity:101/197 - (51%) Gaps:26/197 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1192 LFRGSTKPGALFGAKMSQVLKREKRDIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKLK--- 1253
            |||..     :||.::..:.:||...:|..:..|:..|:::|:...|.|||||:.:.:.||:   
Mouse   432 LFRDQ-----VFGCQLESLCQREGDTVPSFVRLCVEAVDKKGLDVDGIYRVSGNLAVVQKLRFLV 491

  Fly  1254 ---KAFESDA--YEAEQLLRE----------VDIHSVTGILKTFLRELPEALFTDQLYPRFFDTF 1303
               :|..||.  ...||..:|          .|||.|||.||.|.||||:.|....|.|.|.|  
Mouse   492 DRERAVTSDGRYMFPEQAGQEGKLDLDSAEWDDIHVVTGALKLFFRELPQPLVPALLLPDFRD-- 554

  Fly  1304 SAFSNNNESTRINELLKVFEELPQANKASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTLLRP 1368
             |...:.....::::.|:.:.||:.|..::..||:||.||......|:|:.|||.:||||||.||
Mouse   555 -ALELSEPEQCLSKIQKLIDSLPRPNHDTLKYILEHLCRVIAHSDKNRMTAHNLGIVFGPTLFRP 618

  Fly  1369 GQ 1370
            .|
Mouse   619 EQ 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP1ANP_001284725.1 RhoGEF 675..857 CDD:214619
PH_BCR_arthropod 851..1037 CDD:270174
C2 1079..1187 CDD:301316
RhoGAP 1203..1398 CDD:295372 65/186 (35%)
Arhgap9NP_001272714.1 SH3 26..82 CDD:302595
PH_ARHGAP9-like 236..349 CDD:270053
PH 250..348 CDD:278594
ASCH <346..432 CDD:294653 68/197 (35%)
RhoGAP_ARHGAP27_15_12_9 438..642 CDD:239868 65/186 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2255
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.