DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP1A and rrc-1

DIOPT Version :9

Sequence 1:NP_001284725.1 Gene:RhoGAP1A / 5740235 FlyBaseID:FBgn0025836 Length:1404 Species:Drosophila melanogaster
Sequence 2:NP_001024683.1 Gene:rrc-1 / 181195 WormBaseID:WBGene00009800 Length:759 Species:Caenorhabditis elegans


Alignment Length:325 Identity:77/325 - (23%)
Similarity:137/325 - (42%) Gaps:77/325 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1099 VEVDSYGHYFRKATTKKICRSQTPLWNESFMLELEGSQNVRILL-------YEAKERPLLKAK-- 1154
            :|:||.|.:|..|.                    |.|.||..:.       :|..|...|:.:  
 Worm   144 LEIDSRGGHFEPAE--------------------ETSINVPAIAAAVVTKDFEPTESSQLRLRVG 188

  Fly  1155 ---HILKLSLSWLTETTQPKSIKLT---------ETLELGCSFRFIPGE---------------- 1191
               .|.::|.:..:|.|..|: |||         :...||....:.|.:                
 Worm   189 DIVSITEMSTASPSEQTFWKA-KLTISNQKIVDPQNARLGFEIGYFPRDCVMLIDDKRLPNPLNN 252

  Fly  1192 ---------------LFRGSTKPGALFGAKMSQVLKREKRDIPFIIGACIREVERRGMLEVGCYR 1241
                           :||...:. .:||.:::.:..|..:.:|.|:..|...:|.:|:: .|.||
 Worm   253 EQKASTRNARRYMTTMFRNRRRE-PIFGLELTDLYMRTGKKVPVIVEKCCASIEDQGIV-TGIYR 315

  Fly  1242 VSGSASDLAKLKKAFESDAYEAEQLLREVDIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAF 1306
            ..|..|::.:|:..|:|.|........:.||:||:.:||.:.|:||..|||.|.||:..:.|.  
 Worm   316 QCGIQSNIQRLRAKFDSGAEPDLHEFGQRDIYSVSSLLKQYFRQLPNPLFTYQAYPKLIEAFE-- 378

  Fly  1307 SNNNESTRINELLKVFEELPQANKASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTLLRPGQT 1371
            ..::.|.::..|....|.:|:|:..:...:::||.|:.:.::...|:..|||:|:.|.|.||..|
 Worm   379 KEDSLSEKVESLRFSLETMPEAHYRTAKFLMEHLTRLCKSKSLTDMTSKNLAIVWSPNLFRPPPT 443

  Fly  1372  1371
             Worm   444  443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP1ANP_001284725.1 RhoGEF 675..857 CDD:214619
PH_BCR_arthropod 851..1037 CDD:270174
C2 1079..1187 CDD:301316 23/108 (21%)
RhoGAP 1203..1398 CDD:295372 51/169 (30%)
rrc-1NP_001024683.1 PX_domain 41..146 CDD:295365 0/1 (0%)
SH3 168..238 CDD:302595 14/70 (20%)
RhoGAP 276..466 CDD:295372 51/171 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2255
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.