DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP1A and rga-1

DIOPT Version :9

Sequence 1:NP_001284725.1 Gene:RhoGAP1A / 5740235 FlyBaseID:FBgn0025836 Length:1404 Species:Drosophila melanogaster
Sequence 2:NP_001022390.1 Gene:rga-1 / 174751 WormBaseID:WBGene00012203 Length:444 Species:Caenorhabditis elegans


Alignment Length:184 Identity:54/184 - (29%)
Similarity:89/184 - (48%) Gaps:16/184 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly  1199 PGALFGAKMSQVLKREKRDIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKL--------KKA 1255
            |...||..:..:|.....:||.|:...|..:|...:...|.:|.|.:...:.:|        |..
 Worm   243 PTQQFGVPLEFILSHCGGNIPPIVDQLIEYLEAHALTMEGVFRKSANIGSIKRLQDRINKGEKID 307

  Fly  1256 FESD-AYEAEQLLREVDIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNESTRINELL 1319
            ||:| .|:..:.:  ..:|: :.:||||.|.|.|.|.|::|||: ....|..|...:|..:.|.:
 Worm   308 FENDPEYKDNEYV--ASLHA-SVLLKTFFRSLGEPLTTNRLYPK-LAALSEVSKTEKSAAVKEFV 368

  Fly  1320 KVFEELPQANKASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTLLRPGQTQV 1373
            |:   ||:.|...:.:::..|.||.|....|.|:.:||::||||.|..|...:|
 Worm   369 KL---LPRENYILLKTVIKFLTRVAENSKVNLMTANNLSVVFGPNLTWPTDQEV 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP1ANP_001284725.1 RhoGEF 675..857 CDD:214619
PH_BCR_arthropod 851..1037 CDD:270174
C2 1079..1187 CDD:301316
RhoGAP 1203..1398 CDD:295372 53/180 (29%)
rga-1NP_001022390.1 SEC14 74..225 CDD:214706
RhoGAP 242..442 CDD:383032 54/184 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1094
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.