DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP1A and ARHGAP42

DIOPT Version :9

Sequence 1:NP_001284725.1 Gene:RhoGAP1A / 5740235 FlyBaseID:FBgn0025836 Length:1404 Species:Drosophila melanogaster
Sequence 2:NP_689645.2 Gene:ARHGAP42 / 143872 HGNCID:26545 Length:874 Species:Homo sapiens


Alignment Length:581 Identity:124/581 - (21%)
Similarity:211/581 - (36%) Gaps:161/581 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   849 IQMFLNQFNVVNQRLPIESNRNLRRMVRNSFIVELVDGHRKLRHLFLFNDVIACAKYKALGRDRI 913
            |...|.:|    .||.|......||:::|:..| |:....|.|     .:.|..||.   |:.:.
Human    83 IAQSLKEF----ARLLIAVEEERRRLIQNANDV-LIAPLEKFR-----KEQIGAAKD---GKKKF 134

  Fly   914 DYELKWFIPL----------KDVSIYEEADPAVELKESS--PANISQVKRNLRSVRDQLAMEVAN 966
            |.|.:.:..:          |..|..:|||..::.:..:  .|::..|.: ::.|:::...|...
Human   135 DKESEKYYSILEKHLNLSAKKKESHLQEADTQIDREHQNFYEASLEYVFK-IQEVQEKKKFEFVE 198

  Fly   967 ------SGSGAF-RSGDKYRRKLADLESQLVLATPNLVLRLGNKANNKTITFFLSSDFER----- 1019
                  .|...| ..|.:..::.|..:.|       |...|.|..||...|   ..:.||     
Human   199 PLLSFLQGLFTFYHEGYELAQEFAPYKQQ-------LQFNLQNTRNNFEST---RQEVERLMQRM 253

  Fly  1020 ----------TQW-IDSILSLKQKCNLPGANTINSLEVTAFIVAMQKGMKTEMGSYLMRNTNDES 1073
                      :|| ::..|.:::|..| |...|.      ......||.||              
Human   254 KSANQDYRPPSQWTMEGYLYVQEKRPL-GFTWIK------HYCTYDKGSKT-------------- 297

  Fly  1074 LLVGDLYMGVHGLEGLEQANDLYICVEVDSYGHYFRKATTKKICRSQTPLWNESFMLELEGSQNV 1138
                 ..|.|..::...:.|.|     |.|....|:   .|...|.:|...::.|..::|..:..
Human   298 -----FTMSVSEMKSSGKMNGL-----VTSSPEMFK---LKSCIRRKTDSIDKRFCFDIEVVERH 349

  Fly  1139 RILLYEAKERPLLKAKHILKLSLSWLTET-------TQPKSIKLTETLELG-CSFRFIPGELFRG 1195
            .|:..:|......|.         ||...       |.|..|...|.:.|. ..|.|        
Human   350 GIITLQAFSEANRKL---------WLEAMDGKEPIYTLPAIISKKEEMYLNEAGFNF-------- 397

  Fly  1196 STKPGALFGAKMSQVLKREKRDIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKLKKAFESDA 1260
                                      :..||:.||.||:..:|.||:.|..|.:.||.....|..
Human   398 --------------------------VRKCIQAVETRGITILGLYRIGGVNSKVQKLMNTTFSPK 436

  Fly  1261 YEAEQLLREVDIH-----SVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNESTRINELLK 1320
            ...:   .::||.     ::|..||.:||.|.|.|.|.:|:.   |...|..:::::.|:..:..
Human   437 SPPD---IDIDIELWDNKTITSGLKNYLRCLAEPLMTYKLHK---DFIIAVKSDDQNYRVEAVHA 495

  Fly  1321 VFEELPQANKASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTLLRPGQTQVKQKDPLAA 1381
            :..:||:.|:..:..::.||::|......|.|::.||.::|||||:|      .|::.:||
Human   496 LVHKLPEKNREMLDILIKHLVKVSLHSQQNLMTVSNLGVIFGPTLMR------AQEETVAA 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP1ANP_001284725.1 RhoGEF 675..857 CDD:214619 2/7 (29%)
PH_BCR_arthropod 851..1037 CDD:270174 45/220 (20%)
C2 1079..1187 CDD:301316 23/115 (20%)
RhoGAP 1203..1398 CDD:295372 48/184 (26%)
ARHGAP42NP_689645.2 BAR_GAP10-like 19..225 CDD:153318 32/155 (21%)
BAR-PH_GRAF_family 267..376 CDD:269953 26/151 (17%)
RhoGAP_Graf 369..567 CDD:239839 55/228 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 575..720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 749..777
SH3_GRAF3 820..874 CDD:212999
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1094
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.