DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP1A and Arhgap31

DIOPT Version :9

Sequence 1:NP_001284725.1 Gene:RhoGAP1A / 5740235 FlyBaseID:FBgn0025836 Length:1404 Species:Drosophila melanogaster
Sequence 2:NP_064656.2 Gene:Arhgap31 / 12549 MGIID:1333857 Length:1425 Species:Mus musculus


Alignment Length:168 Identity:54/168 - (32%)
Similarity:93/168 - (55%) Gaps:9/168 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1203 FGAKMSQVLKREKRDIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKLKKAFESDAYEAEQLL 1267
            ||..:::.|:...:|:|:::.:|...:|..|::: |.||:||..|::.:|::.|.||  :...|.
Mouse    19 FGCDLTEYLESSGQDVPYVLKSCAEFIETHGIVD-GIYRLSGITSNIQRLRQEFGSD--QCPDLT 80

  Fly  1268 REV---DIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNESTRINELLKVFEELPQAN 1329
            |||   |||.|..:.|.:.||||..|.|.:||.:|.:   |.|:..|..::..:..|..|||..:
Mouse    81 REVYLQDIHCVGSLCKLYFRELPNPLLTYELYEKFTE---AVSHRPEEGQLARIQNVILELPPPH 142

  Fly  1330 KASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTLLR 1367
            ..::..::.||..:....:...|...|||:|:.|.|||
Mouse   143 YRTLEYLIRHLAHIASFSSKTNMHARNLALVWAPNLLR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP1ANP_001284725.1 RhoGEF 675..857 CDD:214619
PH_BCR_arthropod 851..1037 CDD:270174
C2 1079..1187 CDD:301316
RhoGAP 1203..1398 CDD:295372 54/168 (32%)
Arhgap31NP_064656.2 RhoGAP_CdGAP 17..211 CDD:239849 54/168 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..277
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 511..621
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 652..700
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 756..951
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1031..1095
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1196..1260
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1291..1327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2255
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.