DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP1A and CHN1

DIOPT Version :9

Sequence 1:NP_001284725.1 Gene:RhoGAP1A / 5740235 FlyBaseID:FBgn0025836 Length:1404 Species:Drosophila melanogaster
Sequence 2:NP_001358443.1 Gene:CHN1 / 1123 HGNCID:1943 Length:476 Species:Homo sapiens


Alignment Length:462 Identity:111/462 - (24%)
Similarity:190/462 - (41%) Gaps:114/462 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   954 RSVRDQLAMEVANSGSGAFRSGDKYRRKLADLESQLVLATPNLVLRLGNKANNKTITFFLSSDFE 1018
            |...|||.  :...||...|            |||....|..|.||.|::..|..: ::....|.
Human    73 REAADQLL--IVAEGSYLIR------------ESQRQPGTYTLALRFGSQTRNFRL-YYDGKHFV 122

  Fly  1019 RTQWIDSILSLKQKCNLPGANTINSLEVTAFIVAMQKGMKTEMGSYLMRNTNDESLLVGDLYMGV 1083
            ..:..:||..|                ||..::.:.  ::|:...|:.:.|      :..:|..|
Human   123 GEKRFESIHDL----------------VTDGLITLY--IET
KAAEYIAKMT------INPIYEHV 163

  Fly  1084 -------------HGLEGLEQANDLYICVEVDSYGH----------YFRKATTKKICRSQTPLWN 1125
                         | :..|::.:|     |.||.|.          ..|:||.|:  ..|.|   
Human   164 GYTTLNREPAYKKH-MPVLKETHD-----ERDSTGQDGVSEKRLTSLVRRATLKE--NEQIP--- 217

  Fly  1126 ESFMLELEGSQNVRILLYEAKERPLLKAKHILKLSLSWLTETTQPKSIKLTE---TLELGCSFRF 1187
                 :.|...|.::..:        :..|..:...:::.... .:.:|..:   .:...|| :.
Human   218 -----KYEKIHNFKVHTF--------RGPHWCEYCANFMWGLI-AQGVKCADCGLNVHKQCS-KM 267

  Fly  1188 IPGELFRGSTKPG-----ALFGAKMSQVLKREKRDIPFIIGACIREVERRGMLEVGCYRVSGSAS 1247
            :|.:     .||.     .::...::.::|......|.::..||||:|.||:...|.|||||.:.
Human   268 VPND-----CKPDLKHVKKVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSEGLYRVSGFSD 327

  Fly  1248 DLAKLKKAFESDAYEAE-QLLREVDIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNE 1311
            .:..:|.||:.|..:|: .:....||:.:||.||.:.|:||..|.|...||:|.::......:.:
Human   328 LIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDLPIPLITYDAYPKFIESAKIMDPDEQ 392

  Fly  1312 STRINELLKVFEELPQANKASITSILDHLIRV--HEKETDNKMSLHNLAMVFGPTLLRPGQTQVK 1374
            ...::|.||:   ||.|:..::..::.||.||  ||||  |.|:..||.:||||||:|.     .
Human   393 LETLHEALKL---LPPAHCETLRYLMAHLKRVTLHEKE--NLMNAENLGIVFGPTLMRS-----P 447

  Fly  1375 QKDPLAA 1381
            :.|.:||
Human   448 ELDAMAA 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP1ANP_001284725.1 RhoGEF 675..857 CDD:214619
PH_BCR_arthropod 851..1037 CDD:270174 20/82 (24%)
C2 1079..1187 CDD:301316 21/133 (16%)
RhoGAP 1203..1398 CDD:295372 62/182 (34%)
CHN1NP_001358443.1 SH2 67..145 CDD:387587 22/104 (21%)
C1_1 223..272 CDD:365894 6/63 (10%)
RhoGAP_chimaerin 283..476 CDD:239837 62/182 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1094
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.