DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP1A and Chn1

DIOPT Version :9

Sequence 1:NP_001284725.1 Gene:RhoGAP1A / 5740235 FlyBaseID:FBgn0025836 Length:1404 Species:Drosophila melanogaster
Sequence 2:XP_006498620.2 Gene:Chn1 / 108699 MGIID:1915674 Length:541 Species:Mus musculus


Alignment Length:446 Identity:105/446 - (23%)
Similarity:183/446 - (41%) Gaps:94/446 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1001 GNKANNKTITFFLSSDFERTQWIDSILSLKQKCNLPGANTIN------------------SLEVT 1047
            |.:.:...:|.|.:.::....|...:..|:|:...|...|..                  |.|.|
Mouse   103 GRRGSTMALTLFDTDEYRPPVWKSYLYQLQQEAPHPRRVTCTCEVENRPKYYGREYHGMISREET 167

  Fly  1048 AFIVAMQKGMKTEMGSYLMRNTNDE------SLLVGD-------LYMGVH--GLEGLEQANDLY- 1096
            ..::::.:      ||||:|.:..:      :|..|.       .|.|.|  |.:..|..:||. 
Mouse   168 DQLLSVAE------GSYLIRESQRQPGTYTLALRFGSQTRNFRLYYDGKHFVGEKRFESIHDLVT 226

  Fly  1097 -----ICVEVDSYGHYFRKATTKKICR-------SQTPLWNESFML--------ELEGSQNVRIL 1141
                 :.:|..: ..|..|.|...|..       ::.|.:.:...:        |..|...|   
Mouse   227 DGLITLYIETKA-AEYIAKMTINPIYEHIGYTTLNREPAYKQHMAVLKETHDEKEATGQDGV--- 287

  Fly  1142 LYEAKERPLLKAKHILKLSLSWLTETTQPKSIKLTE---TLELGCSFRFIPGELFRGSTKPG--- 1200
              ..|.....:..|..:...:::.... .:.:|..:   .:...|| :.:|.:     .||.   
Mouse   288 --SEKRVHTFRGPHWCEYCANFMWGLI-AQGVKCADCGLNVHKQCS-KMVPND-----CKPDLKH 343

  Fly  1201 --ALFGAKMSQVLKREKRDIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKLKKAFESDAYEA 1263
              .::...::.::|......|.::..||||:|.||:...|.|||||.:..:..:|.||:.|..:|
Mouse   344 VKKVYSCDLTTLVKAHITKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKA 408

  Fly  1264 E-QLLREVDIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNESTRINELLKVFEELPQ 1327
            : .:....||:.:||.||.:.|:||..|.|...||:|.::......:.:...::|.|:   .||.
Mouse   409 DISVNMYEDINIITGALKLYFRDLPIPLITYDAYPKFIESAKIMDPDEQLETLHEALR---SLPP 470

  Fly  1328 ANKASITSILDHLIRV--HEKETDNKMSLHNLAMVFGPTLLRPGQTQVKQKDPLAA 1381
            |:..::..::.||.||  ||||  |.||..||.:||||||:|.     .:.||:||
Mouse   471 AHCETLRYLMAHLKRVTLHEKE--NLMSAENLGIVFGPTLMRS-----PELDPMAA 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP1ANP_001284725.1 RhoGEF 675..857 CDD:214619
PH_BCR_arthropod 851..1037 CDD:270174 6/35 (17%)
C2 1079..1187 CDD:301316 21/133 (16%)
RhoGAP 1203..1398 CDD:295372 63/182 (35%)
Chn1XP_006498620.2 SH2_a2chimerin_b2chimerin 150..236 CDD:198215 17/91 (19%)
C1_1 291..337 CDD:365894 5/52 (10%)
RhoGAP_chimaerin 348..541 CDD:239837 63/182 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1094
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.