Sequence 1: | NP_001284725.1 | Gene: | RhoGAP1A / 5740235 | FlyBaseID: | FBgn0025836 | Length: | 1404 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005165688.1 | Gene: | arhgap31 / 101885883 | ZFINID: | ZDB-GENE-100922-256 | Length: | 1391 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 58/204 - (28%) |
---|---|---|---|
Similarity: | 102/204 - (50%) | Gaps: | 23/204 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 1203 FGAKMSQVLKREKRDIPFIIGACIREVERRGMLEVGCYRVSGSASDLAKLKKAFESDAYEAEQLL 1267
Fly 1268 REV---DIHSVTGILKTFLRELPEALFTDQLYPRFFDTFSAFSNNNESTRINELLKVFEELPQAN 1329
Fly 1330 KASITSILDHLIRVHEKETDNKMSLHNLAMVFGPTLLRPGQTQVKQKDPLAASTVDVMAQAGILY 1394
Fly 1395 CFLQARIKK 1403 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoGAP1A | NP_001284725.1 | RhoGEF | 675..857 | CDD:214619 | |
PH_BCR_arthropod | 851..1037 | CDD:270174 | |||
C2 | 1079..1187 | CDD:301316 | |||
RhoGAP | 1203..1398 | CDD:295372 | 56/197 (28%) | ||
arhgap31 | XP_005165688.1 | RhoGAP_CdGAP | 18..211 | CDD:239849 | 58/204 (28%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2255 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |