DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP1A and arhgap15

DIOPT Version :9

Sequence 1:NP_001284725.1 Gene:RhoGAP1A / 5740235 FlyBaseID:FBgn0025836 Length:1404 Species:Drosophila melanogaster
Sequence 2:NP_001122027.1 Gene:arhgap15 / 100003547 ZFINID:ZDB-GENE-070912-314 Length:465 Species:Danio rerio


Alignment Length:511 Identity:129/511 - (25%)
Similarity:210/511 - (41%) Gaps:117/511 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   935 AVELK-----ESSPANISQVKRNLRSVRDQLAMEVANSGSGAFRSGDKYRRKLADLESQL-VLAT 993
            ||:|:     .|:...:||.|..:....:.|...:           :::||..:...|:: |...
Zfish    12 AVQLRIKNSQSSTGERLSQTKSMVLPEAETLQKPI-----------NRHRRNQSQHNSEVSVGLQ 65

  Fly   994 PNLVLRLGNKA----------NNKTITF-FLSSD---FERTQWIDSILSLKQKCNLPGANTINSL 1044
            |.|.....|||          .|.|:|: .|||:   |.:....:::.:||     ||... :.:
Zfish    66 PVLKGEYLNKAKIAEGGKKLRKNWTLTWVVLSSNQLLFYKESKQEAVSNLK-----PGGKP-DGV 124

  Fly  1045 EVTAFIVAMQKGMKTEMGS-----YLMRNTNDESLLVGDLYMGV---HGLEGLEQANDL------ 1095
            ::...::.    ..||..|     .:...|..|.||..|.:..:   |  :.:::|.|:      
Zfish   125 DLNGAVIE----WTTEKSSRKNVIQITTPTGHEFLLQADHFPTISKWH--DAIKKAVDILSSGSG 183

  Fly  1096 -YICVEVDSYGHYFRKATTKKICRSQTPLWNESFMLELEGSQNVRILLYEAKERPLLKA-----K 1154
             ..|.....:.....:..::..|.|..|...|:      .|::.|.::::........|     |
Zfish   184 GQSCGRAALHRSNSTECLSRPTCESSKPKPKET------KSEHRRSIMFKLNYSASDSADKNGVK 242

  Fly  1155 HILKLSLSWLTETTQPKSIKLTETLELGCSFRFIPGELFRGSTKPGALFGAKMSQVLKREKRDIP 1219
            :.||..:|     .:|....|.|                :|..| ..:||..|..:..|||..:|
Zfish   243 NRLKKFIS-----RRPSMKTLQE----------------KGIIK-DRVFGCHMLTLCDREKTTVP 285

  Fly  1220 FIIGACIREVERRGMLEVGCYRVSGSASDLAKLKKAFESDAYEAEQL--LREVDIHSVTGILKTF 1282
            ..:..|:.|||:||:...|.|||||:.:.:.||:  |..|..|...|  .:..|||.:||.||.|
Zfish   286 KFVKLCVEEVEKRGLEADGIYRVSGNLAIIQKLR--FLVDQEEELDLGDSQWEDIHVITGALKMF 348

  Fly  1283 LRELPEALFTDQLYP-RFFDTFSAFSNNNEST-RINELLKVFEELPQANKASITSILDHLIRVHE 1345
            .|||||.||     | ||||.|.......|.| ::..:.|:..:||:.|..::..:..||.||..
Zfish   349 FRELPEPLF-----PFRFFDLFVETIKIKEPTQKVQAMKKLIHQLPKPNHNTMKLLFHHLRRVLT 408

  Fly  1346 KETDNKMSLHNLAMVFGPTLLRP----GQTQVKQKDPLAASTVDVMAQAGILYCFL 1397
            |...|.||...:::||||||:.|    |..:           |:::.|..|:.|.|
Zfish   409 KSQKNLMSTQGVSIVFGPTLMWPEFESGNME-----------VNMVYQNQIVECIL 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP1ANP_001284725.1 RhoGEF 675..857 CDD:214619
PH_BCR_arthropod 851..1037 CDD:270174 26/121 (21%)
C2 1079..1187 CDD:301316 18/122 (15%)
RhoGAP 1203..1398 CDD:295372 73/203 (36%)
arhgap15NP_001122027.1 PH 67..175 CDD:278594 24/119 (20%)
PH_ARHGAP9-like 68..176 CDD:270053 25/119 (21%)
RhoGAP_ARHGAP27_15_12_9 269..453 CDD:239868 72/201 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1094
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.