DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp14a and Rpp14

DIOPT Version :9

Sequence 1:NP_001097977.1 Gene:Rpp14a / 5740224 FlyBaseID:FBgn0085346 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_080214.1 Gene:Rpp14 / 67053 MGIID:1914303 Length:122 Species:Mus musculus


Alignment Length:93 Identity:24/93 - (25%)
Similarity:48/93 - (51%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGYQYLDVKIKLRDPDSVTLTPVFFCGCIHSSLASIFGEIGGQTILEIVKFSSSQKRSILRVPEN 66
            |.|.|:.|.::.:: ..|.|....|...:.|:|..:|||:|....::::.:......:|||:..:
Mouse    15 SEYHYMKVCLEFQE-HGVGLNVAQFKQLLVSALRDLFGEVGAALPVDVLTYDEKTLSAILRICSS 78

  Fly    67 VLDRVRVAIALIGYYQEVPCHFQVLSTS 94
            .|.::..::.|.|.|:...|.|:|:..|
Mouse    79 GLVKLWSSLTLFGAYKSKKCAFRVIQVS 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp14aNP_001097977.1 RNase_P_Rpp14 6..94 CDD:294403 21/87 (24%)
Rpp14NP_080214.1 RNase_P_Rpp14 33..106 CDD:280137 18/72 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BCSB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5501
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50155
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15441
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10370
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.960

Return to query results.
Submit another query.