DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp14a and Rpp14b

DIOPT Version :9

Sequence 1:NP_001097977.1 Gene:Rpp14a / 5740224 FlyBaseID:FBgn0085346 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_651769.1 Gene:Rpp14b / 43578 FlyBaseID:FBgn0039744 Length:112 Species:Drosophila melanogaster


Alignment Length:109 Identity:56/109 - (51%)
Similarity:75/109 - (68%) Gaps:2/109 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGYQYLDVKIKLRDPDSVTLTPVFFCGCIHSSLASIFGEIGGQTILEIVKFSSSQKRSILRVPE 65
            |:.|.|.|:|:|||||.:|.|||..|..|:..:|.|.|.|  .:..||||||.:.|.|.|.||||
  Fly     1 MANYYYFDIKLKLRDPTAVALTPSLFRSCVLDALDSFFCE--EKPTLEIVKFCAQQHRVIFRVPE 63

  Fly    66 NVLDRVRVAIALIGYYQEVPCHFQVLSTSRKPLDFEESPEEFVA 109
            .:.|..|::|.|||:||::||||::|.||:..||||:|.|:.||
  Fly    64 QLHDMTRISIELIGHYQQIPCHFEILETSKSSLDFEKSIEKTVA 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp14aNP_001097977.1 RNase_P_Rpp14 6..94 CDD:294403 44/87 (51%)
Rpp14bNP_651769.1 RNase_P_Rpp14 6..92 CDD:321066 44/87 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444658
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BCSB
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5506
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019744
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107495
Panther 1 1.100 - - P PTHR15441
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.