DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp14a and Rpp14

DIOPT Version :9

Sequence 1:NP_001097977.1 Gene:Rpp14a / 5740224 FlyBaseID:FBgn0085346 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001101842.2 Gene:Rpp14 / 361020 RGDID:1305436 Length:122 Species:Rattus norvegicus


Alignment Length:93 Identity:25/93 - (26%)
Similarity:48/93 - (51%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGYQYLDVKIKLRDPDSVTLTPVFFCGCIHSSLASIFGEIGGQTILEIVKFSSSQKRSILRVPEN 66
            |.|.|:.|.::.:: ..|.|....|...:.|:|..:|||:|....::::.:..:...:||||..:
  Rat    15 SEYHYMKVCLEFQE-HGVGLNGAQFKQLLVSALKDLFGEVGAALPVDVLTYDETTLSAILRVCSS 78

  Fly    67 VLDRVRVAIALIGYYQEVPCHFQVLSTS 94
            .|.::..::.|.|.|:...|.|:|...|
  Rat    79 GLAKLWSSLTLFGAYKGKKCAFRVSQVS 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp14aNP_001097977.1 RNase_P_Rpp14 6..94 CDD:294403 22/87 (25%)
Rpp14NP_001101842.2 RNase_P_Rpp14 28..106 CDD:396467 20/78 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338052
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BCSB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 41 1.000 Inparanoid score I5410
OMA 1 1.010 - - QHG50155
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107495
Panther 1 1.100 - - LDO PTHR15441
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.760

Return to query results.
Submit another query.