Sequence 1: | NP_001097807.1 | Gene: | CG34274 / 5740212 | FlyBaseID: | FBgn0085303 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_011985.1 | Gene: | TOM71 / 856517 | SGDID: | S000001159 | Length: | 639 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 239 | Identity: | 56/239 - (23%) |
---|---|---|---|
Similarity: | 93/239 - (38%) | Gaps: | 59/239 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 ELFIYQHPAADESFLKEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTRRSAVS 90
Fly 91 TTTFRRGKAKRALINTNQFTFMRQIDSEPDD---RVLAREQREDVAETFRRMGNYEYRKLNFSLA 152
Fly 153 KDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLND 217
Fly 218 --EPNFEYSV-------DRA-------RRFNRSDADFIDEFLDK 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34274 | NP_001097807.1 | TPR_11 | 133..195 | CDD:290150 | 16/61 (26%) |
TPR repeat | 133..161 | CDD:276809 | 8/27 (30%) | ||
TPR repeat | 166..197 | CDD:276809 | 7/30 (23%) | ||
TOM71 | NP_011985.1 | 3a0801s09 | 9..636 | CDD:273380 | 56/239 (23%) |
TPR repeat | 127..155 | CDD:276809 | 8/27 (30%) | ||
TPR repeat | 160..190 | CDD:276809 | 7/30 (23%) | ||
TPR repeat | 195..218 | CDD:276809 | 7/22 (32%) | ||
TPR repeat | 345..373 | CDD:276809 | |||
TPR repeat | 378..406 | CDD:276809 | |||
TPR repeat | 411..441 | CDD:276809 | |||
TPR repeat | 446..471 | CDD:276809 | |||
TPR repeat | 480..508 | CDD:276809 | |||
TPR repeat | 513..559 | CDD:276809 | |||
TPR repeat | 564..588 | CDD:276809 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
2 | 1.870 |