DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and TOM71

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_011985.1 Gene:TOM71 / 856517 SGDID:S000001159 Length:639 Species:Saccharomyces cerevisiae


Alignment Length:239 Identity:56/239 - (23%)
Similarity:93/239 - (38%) Gaps:59/239 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ELFIYQHPAADESFLKEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTRRSAVS 90
            |.|..|:  .||:.||:..:          |:..:||....|.::|                   
Yeast    56 EAFAGQN--EDEADLKDDGS----------VVSGSNKRKKKKNKRK------------------- 89

  Fly    91 TTTFRRGKAKRALINTNQFTFMRQIDSEPDD---RVLAREQREDVAETFRRMGNYEYRKLNFSLA 152
                |..|||    :...|.:....:.|||.   :.|:..||:..|...:..||:.:...||:.|
Yeast    90 ----RNNKAK----SGEGFDYPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEA 146

  Fly   153 KDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLND 217
            ..||...|:...:.||.|.|.:.|:|...:.: .:|:......:|...:.:|.|.||:|.:.|.:
Yeast   147 IKYYQYAIELDPNEPVFYSNISACYISTGDLE-KVIEFTTKALEIKPDHSKALLRRASANESLGN 210

  Fly   218 --EPNFEYSV-------DRA-------RRFNRSDADFIDEFLDK 245
              :..|:.||       |.|       |..|:.....::|.|.|
Yeast   211 FTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNENLSK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 16/61 (26%)
TPR repeat 133..161 CDD:276809 8/27 (30%)
TPR repeat 166..197 CDD:276809 7/30 (23%)
TOM71NP_011985.1 3a0801s09 9..636 CDD:273380 56/239 (23%)
TPR repeat 127..155 CDD:276809 8/27 (30%)
TPR repeat 160..190 CDD:276809 7/30 (23%)
TPR repeat 195..218 CDD:276809 7/22 (32%)
TPR repeat 345..373 CDD:276809
TPR repeat 378..406 CDD:276809
TPR repeat 411..441 CDD:276809
TPR repeat 446..471 CDD:276809
TPR repeat 480..508 CDD:276809
TPR repeat 513..559 CDD:276809
TPR repeat 564..588 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.