DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and CNS1

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_009713.1 Gene:CNS1 / 852452 SGDID:S000000359 Length:385 Species:Saccharomyces cerevisiae


Alignment Length:159 Identity:44/159 - (27%)
Similarity:79/159 - (49%) Gaps:34/159 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 FMRQIDSEPDD-----------RVLARE-QREDVAETFRRMGNYEYRKLNFSLAKDYYSKGI--- 160
            ||.::| |.|.           :.||.| :..::||.|::.||..|:...|..|::.||||:   
Yeast    50 FMTKLD-ETDGAGGENVELEALKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYSKGLAVE 113

  Fly   161 ---QYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLNDEPNFE 222
               :.|.:|  ||.|||.|.::|:.::..|.||...|. |:...::.:...:.|:.:||      
Yeast   114 CEDKSINES--LYANRAACELELKNYRRCIEDCSKALT-INPKNVKCYYRTSKAFFQLN------ 169

  Fly   223 YSVDRARRFNRSDADFIDEFLD-KMRSLL 250
             .::.|    :|.|.|.::.:| :.:|:|
Yeast   170 -KLEEA----KSAATFANQRIDPENKSIL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 24/67 (36%)
TPR repeat 133..161 CDD:276809 12/33 (36%)
TPR repeat 166..197 CDD:276809 12/30 (40%)
CNS1NP_009713.1 3a0801s09 68..>218 CDD:273380 39/140 (28%)
TPR repeat 83..111 CDD:276809 12/27 (44%)
TPR repeat 120..150 CDD:276809 12/32 (38%)
Wheel 257..374 CDD:408742
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.