DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and SGTA

DIOPT Version :10

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_003012.1 Gene:SGTA / 6449 HGNCID:10819 Length:313 Species:Homo sapiens


Alignment Length:103 Identity:29/103 - (28%)
Similarity:44/103 - (42%) Gaps:6/103 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PDD-----RVLAREQREDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDSPVLYVNRALCFI 178
            |.|     |....|:....||..:..||.:.:..||..|..:|.|.|:....:.|.:.|||..:.
Human    72 PQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYS 136

  Fly   179 KLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLN 216
            ||..:...:.||:..:. ||..|.:|:.....|...||
Human   137 KLGNYAGAVQDCERAIC-IDPAYSKAYGRMGLALSSLN 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 3a0801s09 118..>215 CDD:273380 27/100 (27%)
TPR repeat 133..161 CDD:276809 9/27 (33%)
TPR repeat 166..197 CDD:276809 8/30 (27%)
SGTANP_003012.1 SGTA_dimer 5..64 CDD:465168
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..100 7/27 (26%)
Spy 85..>199 CDD:443119 26/90 (29%)
TPR 1 91..124 10/32 (31%)
TPR repeat 91..119 CDD:276809 9/27 (33%)
TPR repeat 124..154 CDD:276809 8/30 (27%)
TPR 2 125..158 10/33 (30%)
TPR 3 159..192 4/15 (27%)
TPR repeat 159..187 CDD:276809 4/15 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..269
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.