DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and ttc12

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_009289931.1 Gene:ttc12 / 563791 ZFINID:ZDB-GENE-071016-4 Length:707 Species:Danio rerio


Alignment Length:200 Identity:46/200 - (23%)
Similarity:95/200 - (47%) Gaps:37/200 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ESFLKEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTRRSAVSTTTFR---RGK 98
            |.||:       ||.:..:::.:.|.:::|.:.          ..||.....:|:...:   :.|
Zfish    15 EKFLR-------DVDQINELVRDLNSSEASCQE----------NAIVKTEQLISSLEQKEQFKTK 62

  Fly    99 AKRALINT----------------NQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKL 147
            ..:.:|||                |...|::.::.:.:||...|:.:|:.|...|..||..:.:.
Zfish    63 INKTVINTSSSENNPLNIRYESSQNPENFLKILEKDAEDRCQRRKMKEERANVLREQGNEAFTQG 127

  Fly   148 NFSLAKDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAY 212
            ::..|..:|::|::.::|...||.|||..||||:.:|..|.||::.| :.:|..::|:::...::
Zfish   128 DYETAVRFYTEGLEQLRDMQALYTNRAQAFIKLKRYKEAISDCEWAL-RCNEKCIKAFIHMGTSH 191

  Fly   213 KRLND 217
            ..|.|
Zfish   192 LALKD 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 21/61 (34%)
TPR repeat 133..161 CDD:276809 7/27 (26%)
TPR repeat 166..197 CDD:276809 14/30 (47%)
ttc12XP_009289931.1 TPR_11 112..178 CDD:290150 22/66 (33%)
TPR repeat 113..141 CDD:276809 7/27 (26%)
TPR repeat 146..176 CDD:276809 14/30 (47%)
TPR_11 149..212 CDD:290150 17/48 (35%)
TPR_1 150..180 CDD:278916 14/30 (47%)
TPR repeat 181..209 CDD:276809 2/15 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11095
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005389
OrthoInspector 1 1.000 - - otm26027
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.