Sequence 1: | NP_001097807.1 | Gene: | CG34274 / 5740212 | FlyBaseID: | FBgn0085303 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009289931.1 | Gene: | ttc12 / 563791 | ZFINID: | ZDB-GENE-071016-4 | Length: | 707 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 46/200 - (23%) |
---|---|---|---|
Similarity: | 95/200 - (47%) | Gaps: | 37/200 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 ESFLKEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTRRSAVSTTTFR---RGK 98
Fly 99 AKRALINT----------------NQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKL 147
Fly 148 NFSLAKDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAY 212
Fly 213 KRLND 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34274 | NP_001097807.1 | TPR_11 | 133..195 | CDD:290150 | 21/61 (34%) |
TPR repeat | 133..161 | CDD:276809 | 7/27 (26%) | ||
TPR repeat | 166..197 | CDD:276809 | 14/30 (47%) | ||
ttc12 | XP_009289931.1 | TPR_11 | 112..178 | CDD:290150 | 22/66 (33%) |
TPR repeat | 113..141 | CDD:276809 | 7/27 (26%) | ||
TPR repeat | 146..176 | CDD:276809 | 14/30 (47%) | ||
TPR_11 | 149..212 | CDD:290150 | 17/48 (35%) | ||
TPR_1 | 150..180 | CDD:278916 | 14/30 (47%) | ||
TPR repeat | 181..209 | CDD:276809 | 2/15 (13%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 55 | 1.000 | Domainoid score | I11095 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0005389 | |
OrthoInspector | 1 | 1.000 | - | - | otm26027 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.910 |