DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and si:dkey-33c12.4

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_021336269.1 Gene:si:dkey-33c12.4 / 560112 ZFINID:ZDB-GENE-030131-2527 Length:648 Species:Danio rerio


Alignment Length:255 Identity:51/255 - (20%)
Similarity:101/255 - (39%) Gaps:63/255 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VDKKN---EHEKPFGLEIPKPELFIYQHPAADE------------SFLKEQPTKVEDVIEYLDVL 57
            ::|:|   |..||..:: |.||.  .:|...|.            |.:...|..:...:...|  
Zfish   165 LEKENANKEKNKPVQVD-PGPEK--TKHADKDNENKDKKCKNKGCSSVPPDPQPISAPVSSSD-- 224

  Fly    58 ENANKTDSSKKRQKSTITMDDI---KCIVTRRSAVSTTTFRRGKAKRAL-------INTNQFTFM 112
              ::..:...|::.|.|..:::   .|.|:..:|:         |||.|       ....|....
Zfish   225 --SSSDEEDDKKEDSAIEPEELDMNSCFVSNAAAI---------AKRKLEQKPKPDKKPAQANPK 278

  Fly   113 RQIDSEPDDRVLAREQ--REDV-------AETF-------RRMGNYEYRKLNFSLAKDYYSKGIQ 161
            :|.:|:....|:.::|  :|:|       |..|       ..:||......|..:|..|::..|:
Zfish   279 KQHESQQKATVMPQKQVAKEEVNGEESVNANDFITRSVELAVIGNEYAGSGNMEMAVKYFTDAIK 343

  Fly   162 YIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYR----AAAYKRLND 217
            :......|:.||:.|:.|:.:::..:.|.:..|: ::..:::. |||    ....||.|:
Zfish   344 HNPKEYKLFGNRSYCYEKMLQYEKSLTDAEIALS-MNPKWIKG-LYRKGRALVGLKRYNE 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 14/68 (21%)
TPR repeat 133..161 CDD:276809 7/34 (21%)
TPR repeat 166..197 CDD:276809 7/30 (23%)
si:dkey-33c12.4XP_021336269.1 PLN03088 258..>439 CDD:330826 32/146 (22%)
TPR repeat 348..378 CDD:276809 7/30 (23%)
TPR repeat 383..411 CDD:276809 6/20 (30%)
UBA 430..456 CDD:270456
RRM <471..>614 CDD:223796
RRM 519..584 CDD:214636
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.