DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and TTC12

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_005271661.1 Gene:TTC12 / 54970 HGNCID:23700 Length:777 Species:Homo sapiens


Alignment Length:203 Identity:48/203 - (23%)
Similarity:96/203 - (47%) Gaps:30/203 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ESFLKEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTI-----------TMDDIKCIVT-RRSAV 89
            :.|||       :|.|..::::..| :|....:||:.:           ..::.:|..| .::.:
Human    10 QKFLK-------NVDEISNLIQEMN-SDDPVVQQKAVLETEKRLLLMEEDQEEDECRTTLNKTMI 66

  Fly    90 STTTFRRGKAKRALINTNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKLNFSLAKD 154
            |...    .|.::....|...|:..::.:..:|...|.:.:.:|:..:..||..:.:.|:..|..
Human    67 SPPQ----TAMKSAEEINSEAFLASVEKDAKERAKRRRENKVLADALKEKGNEAFAEGNYETAIL 127

  Fly   155 YYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLNDEP 219
            .||:|::.:||..|||.|||..::||.:::..::||::.| |.||...:|:.:...|...|.:  
Human   128 RYSEGLEKLKDMKVLYTNRAQAYMKLEDYEKALVDCEWAL-KCDEKCTKAYFHMGKANLALKN-- 189

  Fly   220 NFEYSVDR 227
               |||.|
Human   190 ---YSVSR 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 20/61 (33%)
TPR repeat 133..161 CDD:276809 8/27 (30%)
TPR repeat 166..197 CDD:276809 11/30 (37%)
TTC12XP_005271661.1 TPR_11 106..171 CDD:290150 22/65 (34%)
BamD 106..>164 CDD:276939 19/57 (33%)
TPR repeat 106..138 CDD:276939 8/31 (26%)
TPR repeat 106..134 CDD:276809 8/27 (30%)
TPR repeat 139..169 CDD:276809 11/30 (37%)
TPR_11 142..205 CDD:290150 20/59 (34%)
TPR_1 143..173 CDD:278916 12/30 (40%)
TPR repeat 174..202 CDD:276809 7/26 (27%)
TPR repeat 211..236 CDD:276809
ARM 526..631 CDD:237987
armadillo repeat 555..591 CDD:293788
armadillo repeat 597..631 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I11583
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005389
OrthoInspector 1 1.000 - - otm40328
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.