Sequence 1: | NP_001097807.1 | Gene: | CG34274 / 5740212 | FlyBaseID: | FBgn0085303 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005271661.1 | Gene: | TTC12 / 54970 | HGNCID: | 23700 | Length: | 777 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 48/203 - (23%) |
---|---|---|---|
Similarity: | 96/203 - (47%) | Gaps: | 30/203 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 ESFLKEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTI-----------TMDDIKCIVT-RRSAV 89
Fly 90 STTTFRRGKAKRALINTNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKLNFSLAKD 154
Fly 155 YYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLNDEP 219
Fly 220 NFEYSVDR 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34274 | NP_001097807.1 | TPR_11 | 133..195 | CDD:290150 | 20/61 (33%) |
TPR repeat | 133..161 | CDD:276809 | 8/27 (30%) | ||
TPR repeat | 166..197 | CDD:276809 | 11/30 (37%) | ||
TTC12 | XP_005271661.1 | TPR_11 | 106..171 | CDD:290150 | 22/65 (34%) |
BamD | 106..>164 | CDD:276939 | 19/57 (33%) | ||
TPR repeat | 106..138 | CDD:276939 | 8/31 (26%) | ||
TPR repeat | 106..134 | CDD:276809 | 8/27 (30%) | ||
TPR repeat | 139..169 | CDD:276809 | 11/30 (37%) | ||
TPR_11 | 142..205 | CDD:290150 | 20/59 (34%) | ||
TPR_1 | 143..173 | CDD:278916 | 12/30 (40%) | ||
TPR repeat | 174..202 | CDD:276809 | 7/26 (27%) | ||
TPR repeat | 211..236 | CDD:276809 | |||
ARM | 526..631 | CDD:237987 | |||
armadillo repeat | 555..591 | CDD:293788 | |||
armadillo repeat | 597..631 | CDD:293788 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 51 | 1.000 | Domainoid score | I11583 |
eggNOG | 1 | 0.900 | - | - | E2759_KOG0548 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0005389 | |
OrthoInspector | 1 | 1.000 | - | - | otm40328 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.810 |