DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and CG31294

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_732055.1 Gene:CG31294 / 318666 FlyBaseID:FBgn0051294 Length:225 Species:Drosophila melanogaster


Alignment Length:228 Identity:106/228 - (46%)
Similarity:139/228 - (60%) Gaps:21/228 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ADESFLKEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTRRSAVSTTTFR---- 95
            |||||| .|.:.:.||::.|:.|:||||.|:..|.:      ::.|..|.....|:.|.|.    
  Fly     3 ADESFL-NQRSLLMDVMKQLEDLQNANKMDTGTKGK------EEKKPEVDPSEGVTITNFMVFAR 60

  Fly    96 --RGKAKRAL------INTNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYRKLNFSLA 152
              |.|:.|.|      .|.||.:||||||..|.||..||..||.||::|||:||.|||:.|:..|
  Fly    61 DVRKKSSRYLKRVQKMSNINQISFMRQIDVSPKDRAEARRDREIVADSFRRLGNEEYRRTNYEKA 125

  Fly   153 KDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLND 217
            ..:|||.|||:.||||||.||||..||.|:|||.:.|.|||:..:|..:||||||||.|..|||:
  Fly   126 VYFYSKAIQYVADSPVLYCNRALAKIKKRDFKLALFDLDYVIFNLDPIHLRAWLYRAGALARLNN 190

  Fly   218 EPNFEYSVDRARRFNRSDAD--FIDEFLDKMRS 248
            |..||.::..||..|||..|  :|:.||:|.::
  Fly   191 ESEFEIAIANARLLNRSQKDKKYIEYFLEKFKT 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 37/61 (61%)
TPR repeat 133..161 CDD:276809 14/27 (52%)
TPR repeat 166..197 CDD:276809 19/30 (63%)
CG31294NP_732055.1 TPR_11 106..172 CDD:290150 37/65 (57%)
TPR repeat 106..134 CDD:276809 14/27 (52%)
TPR repeat 139..170 CDD:276809 19/30 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449138
Domainoid 1 1.000 44 1.000 Domainoid score I4681
eggNOG 1 0.900 - - E2759_KOG0548
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005389
OrthoInspector 1 1.000 - - otm26027
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.