DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and Ttc12

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_006243066.1 Gene:Ttc12 / 300696 RGDID:1303264 Length:723 Species:Rattus norvegicus


Alignment Length:202 Identity:49/202 - (24%)
Similarity:98/202 - (48%) Gaps:11/202 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PKPELFIYQHPAADESFLKEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTR-- 85
            |.|.|......|.|:.  ::....:|:|.|..::::..| :|....:||:.:..:....::.|  
  Rat    10 PPPALRFVSAMADDQE--RDLQRFLENVDEITNLIQEMN-SDDPFIQQKAVLDTEKKLLLMEREQ 71

  Fly    86 -----RSAVSTTTFRRGKAKRALINTNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYR 145
                 |:.::.|.....:|.......|...|:..::.:..:|...|.:...:|:..:..||..:.
  Rat    72 EEDGCRTTLNKTMISPPQAPENANEMNPDAFLASVEKDAKERAKRRRENRVLADALKEKGNEAFV 136

  Fly   146 KLNFSLAKDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAA 210
            |.::..|..:||:|:..:||..|||.|||..:|||.:::..::|||:.| |.||:..:|:.:...
  Rat   137 KGDYETAIFFYSEGLGKLKDMKVLYTNRAQAYIKLGDYQKALVDCDWAL-KCDENCTKAYFHMGK 200

  Fly   211 AYKRLND 217
            |:..|.:
  Rat   201 AHLALKN 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 22/61 (36%)
TPR repeat 133..161 CDD:276809 8/27 (30%)
TPR repeat 166..197 CDD:276809 13/30 (43%)
Ttc12XP_006243066.1 TPR_11 124..189 CDD:290150 24/65 (37%)
TPR repeat 124..152 CDD:276809 8/27 (30%)
TPR repeat 157..187 CDD:276809 13/30 (43%)
TPR_11 160..223 CDD:290150 18/49 (37%)
TPR_1 161..191 CDD:278916 14/30 (47%)
TPR repeat 192..217 CDD:276809 3/16 (19%)
TPR_1 193..224 CDD:278916 3/15 (20%)
ARM 631..723 CDD:237987
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005389
OrthoInspector 1 1.000 - - otm44459
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.