Sequence 1: | NP_001097807.1 | Gene: | CG34274 / 5740212 | FlyBaseID: | FBgn0085303 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006243066.1 | Gene: | Ttc12 / 300696 | RGDID: | 1303264 | Length: | 723 | Species: | Rattus norvegicus |
Alignment Length: | 202 | Identity: | 49/202 - (24%) |
---|---|---|---|
Similarity: | 98/202 - (48%) | Gaps: | 11/202 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 PKPELFIYQHPAADESFLKEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTR-- 85
Fly 86 -----RSAVSTTTFRRGKAKRALINTNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYEYR 145
Fly 146 KLNFSLAKDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAA 210
Fly 211 AYKRLND 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34274 | NP_001097807.1 | TPR_11 | 133..195 | CDD:290150 | 22/61 (36%) |
TPR repeat | 133..161 | CDD:276809 | 8/27 (30%) | ||
TPR repeat | 166..197 | CDD:276809 | 13/30 (43%) | ||
Ttc12 | XP_006243066.1 | TPR_11 | 124..189 | CDD:290150 | 24/65 (37%) |
TPR repeat | 124..152 | CDD:276809 | 8/27 (30%) | ||
TPR repeat | 157..187 | CDD:276809 | 13/30 (43%) | ||
TPR_11 | 160..223 | CDD:290150 | 18/49 (37%) | ||
TPR_1 | 161..191 | CDD:278916 | 14/30 (47%) | ||
TPR repeat | 192..217 | CDD:276809 | 3/16 (19%) | ||
TPR_1 | 193..224 | CDD:278916 | 3/15 (20%) | ||
ARM | 631..723 | CDD:237987 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0548 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0005389 | |
OrthoInspector | 1 | 1.000 | - | - | otm44459 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |