DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and cns1

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_594238.1 Gene:cns1 / 2542172 PomBaseID:SPAC17A2.04c Length:358 Species:Schizosaccharomyces pombe


Alignment Length:167 Identity:40/167 - (23%)
Similarity:72/167 - (43%) Gaps:32/167 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 FMRQIDSEPDD----------RVLARE-QREDVAETFRRMGNYEYRKLNFSLAKDYYSKGI-QYI 163
            ||:.::...|:          :.||.| :..:||:.||..||..:....:..|:::|:|.: |..
pombe    31 FMQSLEDVGDESENNVQLDALKALAYEGEPHEVAQNFREHGNECFASKRYKDAEEFYTKALAQKC 95

  Fly   164 KDSPV---LYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAA----AYKRLND---- 217
            .|..:   .|.|||.|.:....::..:.||..||.: |..:.:|: ||:|    |.||.::    
pombe    96 GDKDIEIACYSNRAACNLLFENYRQVLNDCAQVLQR-DSTHAKAY-YRSAKALVALKRYDEAKEC 158

  Fly   218 -------EPNFEYSVDRARRFNRSDADFIDEFLDKMR 247
                   .||....:..::...:...||.....:|.|
pombe   159 IRLCSLVHPNDPAILALSKELQKKSDDFEKRESEKKR 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 18/65 (28%)
TPR repeat 133..161 CDD:276809 8/28 (29%)
TPR repeat 166..197 CDD:276809 9/33 (27%)
cns1NP_594238.1 TPR_11 64..132 CDD:290150 19/68 (28%)
TPR repeat 64..92 CDD:276809 8/27 (30%)
TPR repeat 97..131 CDD:276809 10/33 (30%)
TPR_19 116..175 CDD:291240 14/60 (23%)
TPR repeat 136..160 CDD:276809 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.