| Sequence 1: | NP_001097807.1 | Gene: | CG34274 / 5740212 | FlyBaseID: | FBgn0085303 | Length: | 250 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_058017.1 | Gene: | Stip1 / 20867 | MGIID: | 109130 | Length: | 543 | Species: | Mus musculus |
| Alignment Length: | 241 | Identity: | 52/241 - (21%) |
|---|---|---|---|
| Similarity: | 100/241 - (41%) | Gaps: | 52/241 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 23 PKPELFIYQHPAADESFLKEQ--------------------------PTKVEDVIEYLDVLENAN 61
Fly 62 KTDSSKKRQ--KSTITM-----DDIKCIVTRRSAVSTTTFRRGKAKRALINTNQFTFMRQIDSEP 119
Fly 120 D--------DRVLAREQR-----EDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDSPVLYV 171
Fly 172 NRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLND 217 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG34274 | NP_001097807.1 | TPR_11 | 133..195 | CDD:290150 | 20/61 (33%) |
| TPR repeat | 133..161 | CDD:276809 | 6/27 (22%) | ||
| TPR repeat | 166..197 | CDD:276809 | 13/30 (43%) | ||
| Stip1 | NP_058017.1 | TPR 1 | 4..37 | ||
| TPR_11 | 6..69 | CDD:290150 | |||
| TPR | 7..37 | CDD:197478 | |||
| TPR repeat | 7..32 | CDD:276809 | |||
| TPR repeat | 37..67 | CDD:276809 | |||
| TPR 2 | 39..71 | ||||
| TPR_11 | 40..100 | CDD:290150 | |||
| TPR repeat | 72..100 | CDD:276809 | |||
| TPR 3 | 73..105 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 191..233 | 8/23 (35%) | |||
| Bipartite nuclear localization signal. /evidence=ECO:0000255 | 222..239 | 3/16 (19%) | |||
| TPR_11 | 224..287 | CDD:290150 | 10/64 (16%) | ||
| TPR 4 | 225..258 | 4/32 (13%) | |||
| TPR repeat | 229..253 | CDD:276809 | 0/23 (0%) | ||
| TPR_1 | 231..258 | CDD:278916 | 1/26 (4%) | ||
| TPR_12 | 255..328 | CDD:290160 | 15/74 (20%) | ||
| TPR repeat | 258..288 | CDD:276809 | 6/31 (19%) | ||
| TPR 5 | 260..292 | 6/33 (18%) | |||
| TPR 6 | 300..333 | 5/35 (14%) | |||
| TPR | 300..328 | CDD:197478 | 5/27 (19%) | ||
| TPR repeat | 300..328 | CDD:276809 | 5/27 (19%) | ||
| TPR_11 | 360..425 | CDD:290150 | 20/65 (31%) | ||
| TPR 7 | 360..393 | 7/32 (22%) | |||
| TPR_1 | 364..393 | CDD:278916 | 6/28 (21%) | ||
| TPR repeat | 364..388 | CDD:276809 | 5/23 (22%) | ||
| TPR_11 | 393..458 | CDD:290150 | 17/52 (33%) | ||
| TPR repeat | 393..423 | CDD:276809 | 13/30 (43%) | ||
| TPR_1 | 394..427 | CDD:278916 | 13/33 (39%) | ||
| TPR 8 | 395..427 | 13/32 (41%) | |||
| TPR 9 | 428..461 | 4/16 (25%) | |||
| TPR repeat | 428..456 | CDD:276809 | 4/16 (25%) | ||
| STI1 | 492..531 | CDD:128966 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0548 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||