| Sequence 1: | NP_001097807.1 | Gene: | CG34274 / 5740212 | FlyBaseID: | FBgn0085303 | Length: | 250 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_620266.1 | Gene: | Stip1 / 192277 | RGDID: | 621599 | Length: | 543 | Species: | Rattus norvegicus |
| Alignment Length: | 239 | Identity: | 53/239 - (22%) |
|---|---|---|---|
| Similarity: | 108/239 - (45%) | Gaps: | 31/239 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 PLTTNTVDKKNE--HEKPFGLEIPKPELFIYQHPAADESFLKE-QPTKVEDVIEYLDVLENANKT 63
Fly 64 DSSKKRQ--KSTITM-----DDIKCIVTRRSAVSTTTFRRGKAKRALINTNQFTFMRQIDSEPD- 120
Fly 121 -------DRVLAREQR-----EDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKDSPVLYVNR 173
Fly 174 ALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLND 217 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG34274 | NP_001097807.1 | TPR_11 | 133..195 | CDD:290150 | 20/61 (33%) |
| TPR repeat | 133..161 | CDD:276809 | 6/27 (22%) | ||
| TPR repeat | 166..197 | CDD:276809 | 13/30 (43%) | ||
| Stip1 | NP_620266.1 | TPR 1 | 4..37 | ||
| 3a0801s09 | <7..532 | CDD:273380 | 53/239 (22%) | ||
| TPR repeat | 7..32 | CDD:276809 | |||
| TPR repeat | 37..67 | CDD:276809 | |||
| TPR 2 | 39..71 | ||||
| TPR repeat | 72..100 | CDD:276809 | |||
| TPR 3 | 73..105 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 191..233 | 4/19 (21%) | |||
| Bipartite nuclear localization signal. /evidence=ECO:0000255 | 222..239 | 5/16 (31%) | |||
| TPR 4 | 225..258 | 9/34 (26%) | |||
| TPR repeat | 229..253 | CDD:276809 | 5/25 (20%) | ||
| TPR repeat | 258..288 | CDD:276809 | 6/31 (19%) | ||
| TPR 5 | 260..292 | 6/33 (18%) | |||
| TPR 6 | 300..333 | 4/35 (11%) | |||
| TPR repeat | 300..328 | CDD:276809 | 4/27 (15%) | ||
| TPR 7 | 360..393 | 7/32 (22%) | |||
| TPR repeat | 364..388 | CDD:276809 | 5/23 (22%) | ||
| TPR repeat | 393..423 | CDD:276809 | 13/30 (43%) | ||
| TPR 8 | 395..427 | 13/32 (41%) | |||
| TPR 9 | 428..461 | 4/16 (25%) | |||
| TPR repeat | 428..456 | CDD:276809 | 4/16 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0548 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||