DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and Y22D7AL.9

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_497427.2 Gene:Y22D7AL.9 / 175314 WormBaseID:WBGene00021247 Length:836 Species:Caenorhabditis elegans


Alignment Length:219 Identity:40/219 - (18%)
Similarity:78/219 - (35%) Gaps:79/219 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NTVDKKNEHEKPFGLEIPKPELF-----IYQHPAADESFLKEQPTKVEDVI--EYLDV-----LE 58
            |..:.||. |.|..:.:.|...|     ||:|         ::.|....|:  :|:|:     ||
 Worm   398 NQENSKNS-EFPAEISVHKANAFRLLAIIYEH---------QKDTGSAHVLWKKYVDLGVLTPLE 452

  Fly    59 NANKTDSSKKRQKSTITMDDIKCIVTRRSAVSTTTFRRG--------------------KAKRAL 103
            ..|......:..:....|||::.:..|...:.....|..                    :|::.|
 Worm   453 KLNGLLQIARIAQLEGIMDDVEAVFERAQGICDRLSRPSEKVPYISAKYRWLQSTGISEEAEKCL 517

  Fly   104 ------INTNQFTFMRQIDSEPDD---------------RVLAREQ----REDVAETFR------ 137
                  :.|:|     .:||:...               :::|.||    .:|..:.:|      
 Worm   518 KMLEFWLKTDQ-----NLDSKAKSLIFEDLSLENRPKIGKLIALEQALTEAQDTNDMYREAGILE 577

  Fly   138 RMGNYEYRKLNFSLAKDYYSKGIQ 161
            :||:: ..:.|..||:.||::.::
 Worm   578 KMGHF-LAENNEKLAEKYYNQQLE 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 8/35 (23%)
TPR repeat 133..161 CDD:276809 8/33 (24%)
TPR repeat 166..197 CDD:276809
Y22D7AL.9NP_497427.2 PEP_TPR_lipo <9..93 CDD:274350
TPR repeat 38..68 CDD:276809
TPR repeat 73..96 CDD:276809
TPR_12 611..684 CDD:315987
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.