| Sequence 1: | NP_001097807.1 | Gene: | CG34274 / 5740212 | FlyBaseID: | FBgn0085303 | Length: | 250 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001269581.1 | Gene: | STIP1 / 10963 | HGNCID: | 11387 | Length: | 590 | Species: | Homo sapiens |
| Alignment Length: | 247 | Identity: | 53/247 - (21%) |
|---|---|---|---|
| Similarity: | 106/247 - (42%) | Gaps: | 48/247 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 10 KKNEHEKPFGLEIPKPELFIYQHPAADESFLKEQPTKVED---VIEYLD---VLENANKT----- 63
Fly 64 --------DSSKKRQ--KSTITM-----DDIKCIVTRRSAVSTTTFRRGKAKRALINTNQFTFMR 113
Fly 114 QIDSEPD--------DRVLAREQR-----EDVAETFRRMGNYEYRKLNFSLAKDYYSKGIQYIKD 165
Fly 166 SPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYRAAAYKRLND 217 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG34274 | NP_001097807.1 | TPR_11 | 133..195 | CDD:290150 | 20/61 (33%) |
| TPR repeat | 133..161 | CDD:276809 | 6/27 (22%) | ||
| TPR repeat | 166..197 | CDD:276809 | 13/30 (43%) | ||
| STIP1 | NP_001269581.1 | PLN03088 | <54..579 | CDD:330826 | 53/247 (21%) |
| TPR repeat | 54..79 | CDD:276809 | |||
| TPR repeat | 84..114 | CDD:276809 | |||
| TPR repeat | 119..147 | CDD:276809 | |||
| TPR repeat | 276..300 | CDD:276809 | 4/23 (17%) | ||
| TPR repeat | 305..335 | CDD:276809 | 6/29 (21%) | ||
| TPR repeat | 347..375 | CDD:276809 | 5/27 (19%) | ||
| TPR repeat | 411..435 | CDD:276809 | 5/23 (22%) | ||
| TPR repeat | 440..470 | CDD:276809 | 13/30 (43%) | ||
| TPR repeat | 475..503 | CDD:276809 | 4/16 (25%) | ||
| TPR repeat | 509..538 | CDD:276809 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0548 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||