DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG34274 and SUGT1

DIOPT Version :9

Sequence 1:	NP_001097807.1	Gene:	CG34274 / 5740212	FlyBaseID:	FBgn0085303	Length:	250	Species:	Drosophila melanogaster
Sequence 2:	NP_001124384.1	Gene:	SUGT1 / 10910	HGNCID:	16987	Length:	365	Species:	Homo sapiens

Alignment Length:	83	Identity:	16/83 - (19%)
Similarity:	31/83 - (37%)	Gaps:	38/83 - (45%)

- Green bases have known domain annotations that are detailed below.

  Fly   115 IDSEP----DDRVLAREQREDVAETFRR-------MGNY-------------------------- 142
            ||.:|    ::...|.||:.|.|:.:.:       :|||
Human    23 IDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKKSLELNPNNSTAMLRKGI 87

  Fly   143 -EYRKLNFSLAKDYYSKG 159
             ||.:.|::.|.:.:::|
Human    88 CEYHEKNYAAALETFTEG 105

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG34274	NP_001097807.1	TPR_11	133..195	CDD:290150	9/61 (15%)
		TPR repeat	133..161	CDD:276809	9/61 (15%)
		TPR repeat	166..197	CDD:276809
SUGT1	NP_001124384.1	TPR 1	11..44		6/20 (30%)
		PLN03088	21..365	CDD:215568	16/83 (19%)
		TPR repeat	44..74	CDD:276809	4/29 (14%)
		TPR 2	45..78		4/32 (13%)
		TPR 3	79..112		5/27 (19%)
		TPR repeat	79..107	CDD:276809	5/27 (19%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0548
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900