DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34274 and ttc12

DIOPT Version :9

Sequence 1:NP_001097807.1 Gene:CG34274 / 5740212 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_004916149.1 Gene:ttc12 / 101732246 XenbaseID:XB-GENE-955705 Length:714 Species:Xenopus tropicalis


Alignment Length:249 Identity:63/249 - (25%)
Similarity:111/249 - (44%) Gaps:55/249 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PAAD--ESFLKEQPTKVEDVIEYLDVLENANKTDSSKKRQKSTITMDDIKCIVTRR---SAVSTT 92
            |..|  |||||       ::.|..|::::.|.:|.| .||::.:..|....::..:   ..:.||
 Frog     2 PTKDNLESFLK-------NIDEITDIIQDLNSSDES-HRQEAFLKADKRLALLKNKDNDDGIRTT 58

  Fly    93 TFRRGKAKRALINTN--------------------QFTFMRQIDSEPDDRVLAREQREDVAETFR 137
                  |.|.:|||:                    |...:..::.:..:|...|::...:|...:
 Frog    59 ------ANRTVINTSPEGMCASGSTYHANKDSRLMQENVLEHLEKDAKERAERRKENTAMANALK 117

  Fly   138 RMGNYEYRKLNFSLAKDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYL 202
            .:||..:.|.::..|...||:|::.::|..|||.|||..||||.:::..|.||.:.| |.:|...
 Frog   118 ELGNKAFSKGDYETAVKCYSEGVEKLRDMQVLYTNRAQAFIKLEKYENAISDCQWAL-KCNEKCA 181

  Fly   203 RAWLYRAAAY--------------KRLNDEPNFEYSV-DRARRFNRSDADFIDE 241
            :|:::...||              |.|:.:||.|..| |.....:..:|:|..|
 Frog   182 KAYVHMGKAYLGLKEYSEARKCYLKLLDVDPNLEKLVKDYINTVDLQEANFKQE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 22/61 (36%)
TPR repeat 133..161 CDD:276809 8/27 (30%)
TPR repeat 166..197 CDD:276809 14/30 (47%)
ttc12XP_004916149.1 PLN03088 112..>220 CDD:215568 34/108 (31%)
TPR repeat 113..141 CDD:276809 8/27 (30%)
TPR repeat 146..176 CDD:276809 14/30 (47%)
TPR repeat 181..209 CDD:276809 4/27 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 78 1.000 Domainoid score I8614
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005389
OrthoInspector 1 1.000 - - otm47502
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.