DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34323 and hog

DIOPT Version :9

Sequence 1:NP_001096962.1 Gene:CG34323 / 5740207 FlyBaseID:FBgn0085352 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_727787.1 Gene:hog / 318105 FlyBaseID:FBgn0266710 Length:149 Species:Drosophila melanogaster


Alignment Length:115 Identity:53/115 - (46%)
Similarity:75/115 - (65%) Gaps:11/115 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTFYLEHVLTGDRINLNEGIQILGRHSSCTWVLKYDYMSRYHALIHVNQGDIFIKEMETNNGIFL 65
            |.:||:||:||.|:.||.||.:||:..:|..||.||.||..||::.|..|.||||::|:.:||:|
  Fly     1 MGYYLKHVMTGYRVYLNTGIHLLGKSGACNVVLTYDNMSDIHAVVVVRNGRIFIKDLESIHGIYL 65

  Fly    66 NYWPTRIGSSWCEVNVGDVLYFGV-----QLGIEHDGEIPNTFGIFTVKS 110
            |:...|:||.:.|:.|||.:.|||     :||      .|.|:|.|||:|
  Fly    66 NFKEHRLGSEFYEIFVGDDVAFGVATFGQELG------TPLTYGCFTVRS 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34323NP_001096962.1 FHA 22..87 CDD:278899 29/64 (45%)
FHA <24..95 CDD:224630 33/75 (44%)
hogNP_727787.1 FHA 21..87 CDD:278899 29/65 (45%)
FHA <29..104 CDD:224630 34/80 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454080
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019624
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.